KEGG   Sulfitobacter sp. AM1-D1: BOO69_19185Help
Entry
BOO69_19185       CDS       T04555                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00860  Porphyrin and chlorophyll metabolism
suam01100  Metabolic pathways
suam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BOO69_19185
Enzymes [BR:suam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     BOO69_19185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red Prok-E2_B
Motif
Other DBs
NCBI-ProteinID: APE45682
UniProt: A0A1J0WN04
Position
unnamed1:complement(128604..130166)
Genome map
AA seq 520 aa AA seqDB search
MKLTVWTYEGPPHVGAMRVATGMKGLHYVLHAPQGDTYADLLFTMIERRDHRPPVTYTTF
QARDLGSDTAGLFKKACQDAYDRFRPEAIIVGASCTAELIQDDPGGLAETMGLPIPVIPL
ELPSYQRKENFGADETFFQIVRHLARPMERTARVSCNLLGPTALGFRHRDDVAEITNLLY
ELGIEVNVTAPMGATPSDIARMGQAHFNVLLYPETGEQAARYCERTFGQPYTKVVPIGTG
ATHDFIAEVRALSGSDAPLDTNRLRQTWWSASVDSTYLTGKRVFIFGDGSHVLTAARIAR
DEMGFEVAGMGCYNREFARPVRALARAYGLEALITDDYLEVERTVEALQPEMILGTQMER
HIGKRLGIPCAVISAPVHVQDFPARYSPQMGFEGANVIFDTWVHPLVMGLEEHLLHMFRE
DFEFNDAAGPSHHGGHAPAVRLHPEPASAAAQAHMDHADREQPVAGGEVIWLDRAERELK
KIPFFVRGKARRNTESYAAERGLREISLDTLYEAKAHFAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgacggtctggacatacgaaggcccgccgcacgtcggcgccatgcgcgtcgcg
acgggcatgaaggggctgcattacgtcctgcacgcgccgcagggcgacacctacgcggat
ctgctcttcaccatgatcgaacggcgggaccatcgcccgccggtcacctataccacgttt
caggcacgcgacctcgggtcggacacggcgggcctgttcaagaaagcctgtcaggacgcc
tacgaccgcttccgacccgaggcgatcatcgtcggggcatcctgcacggcggagttgatc
caggacgatcccggcgggctggccgaaacgatgggcctgcctattccggtgatcccgctg
gaattgcccagctaccagcgcaaggaaaacttcggcgcggacgagaccttcttccagatc
gtccggcacctggccaggccgatggaacggacggcacgcgtgtcatgcaatctgctcggg
ccgacggctctggggttccgccaccgcgatgacgtggccgagatcaccaacctgctctac
gaactggggatcgaggtgaacgtcaccgccccgatgggggccacgccctcggacatcgcg
cggatggggcaggcgcactttaacgtgctgctctatcccgaaaccggcgaacaggccgcc
cgctactgcgaacggaccttcggccagccctacacgaaagtggtccccatcgggacaggc
gcgacccacgacttcatcgcggaggtgcgggcgctgtcgggctcagacgcgccgctcgac
accaaccgcctgcgccagacatggtggtccgcgtcggtcgacagcacctaccttaccggc
aagcgggtcttcattttcggcgatggaagccacgtgctgacagcggcgcgcatcgcccga
gacgagatgggcttcgaggtggccggcatgggctgctacaaccgcgaattcgcccgcccg
gtgcgcgccctcgcccgcgcgtacgggctggaggccctgatcaccgacgactacctcgag
gtcgaacgcacggtcgaggccctgcagccggaaatgattctcggcactcagatggagcgc
catatcggcaagcgacttggcatcccgtgcgcggtgatctcggccccggtccacgtgcag
gactttccggcgcgctattccccgcagatggggttcgagggcgccaacgtgatcttcgac
acctgggtgcatccgctggtcatgggactggaagagcatctgctgcacatgttccgcgag
gatttcgagttcaacgatgcggcaggcccgtcccaccatggcggtcacgcacccgcagtg
cgcctgcaccccgaacctgcctccgcggcagcgcaggcgcacatggatcatgccgaccgg
gaacagccggtggcggggggcgaggtgatctggctggaccgggccgagcgcgaattgaag
aagattcccttcttcgtgcgcggcaaggcccggcgcaacaccgaaagctatgccgccgaa
agggggctgcgcgagatcagcctcgacaccctgtacgaggcgaaggcccactttgcgcga
tga

DBGET integrated database retrieval system