KEGG   Sulfitobacter sp. AM1-D1: BOO69_22540Help
Entry
BOO69_22540       CDS       T04555                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
suam  Sulfitobacter sp. AM1-D1
Pathway
suam00903  Limonene and pinene degradation
suam00930  Caprolactam degradation
suam01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:suam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BOO69_22540
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BOO69_22540
Enzymes [BR:suam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BOO69_22540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 COesterase Thioesterase DLH Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: APE46310
UniProt: A0A1J0WQ91
Position
unnamed5:334754..335656
Genome map
AA seq 300 aa AA seqDB search
MEISREADTLRALYQNWTDQMVENPDLTIANLRSMFDEWGQPALEPENVSYKSDHVGGVE
AIWALPAGADTSRVIVYTHGGGFAVGSADSHRKMAGHLAKVLGVTSVILHYRRAPEHPFP
AQIEDAVAAYKALLDKGFKARNILTAGDSAGGNLAIASVLKLRELGLPLPGAVIAYSPWL
DMAMRGETLETNAETDALVGKPILEAMAGMFLGEGTDPLNPLANPLENDFTGYPPLYINA
GGAETLRSDAERLHEKAKAQGVNVTLSIVEGMQHVFPALSGRAPEANEELGRIAAWYQAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcagtagagaagccgatacgctgcgggcgctttatcagaattggaccgatcag
atggtcgagaacccagacctgacgatcgcgaacctgcgcagcatgttcgatgaatggggg
cagcccgcactagagccggaaaacgttagctacaaaagcgatcatgtcggaggagttgag
gctatctgggccctaccagccggggcagatacctcgcgtgtaattgtttacactcatggt
ggcggctttgccgtcggctcagccgatagtcatcgaaaaatggcagggcacctcgctaag
gtgcttggggttacgtcggtgatcctgcactatcggcgcgcacccgagcacccatttccg
gcgcagatcgaagatgcagtagccgcatacaaagcgctgctggataagggtttcaaggca
agaaatattctgacggctggcgacagtgctggcggcaatcttgccatcgccagcgtgctg
aagttacgcgaacttgggttgccactgcccggagcggtcatcgcctattcgccctggctc
gacatggcgatgcgcggggaaacactggaaaccaacgcggaaaccgatgcgctagtcggc
aaaccgatcctcgaagcgatggcggggatgttcctcggtgaaggcacggatccgcttaat
ccgttggccaacccgctggagaacgatttcaccggttacccgccgctttatatcaatgcc
ggaggggctgagacgcttaggagcgatgccgagcggttgcacgaaaaggccaaggcacag
ggcgtaaatgtgaccctgtctatcgtcgaaggcatgcagcatgtctttcccgcgctttcg
ggacgcgcgcccgaggcgaacgaggaacttggtcgcatcgccgcatggtatcaggccctc
tga

DBGET integrated database retrieval system