KEGG   Streptococcus uberis: SUB0174Help
Entry
SUB0174           CDS       T00849                                 

Definition
(GenBank) putative ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
sub  Streptococcus uberis
Brite
KEGG Orthology (KO) [BR:sub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sub03009]
    SUB0174
Enzymes [BR:sub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SUB0174
Ribosome biogenesis [BR:sub03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SUB0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Ubie_methyltran Methyltransf_8 Methyltransf_23 Methyltransf_12 Methyltransf_32 ADH_zinc_N_2 MTS tRNA_U5-meth_tr ADH_zinc_N PCMT
Motif
Other DBs
NCBI-ProteinID: CAR40624
UniProt: B9DT51
Position
complement(174324..175145)
Genome map
AA seq 273 aa AA seqDB search
MSSFSQSVALFQCPICHMSLHLSGTSLLCPQRHTFDMAKQGYVNLLLNAKKDPHYDKNSF
IQRSRILEAGFYSHILEALKEELKSNQRLTILDVACGEGYYARALSENPSYQLLAFDLSK
DSVLLAAKKDPQKRVSWFVGDLAKLPLADDSVDVILDIFSPANYQEFLRVLKPGGKLIKM
VTASDHLQELREAAAAQLQSKTYSNQAIVDHFAEAFPDFNMTHLSQTYPIEDKALAHFVQ
MTPLFFNVNTKAIPLASIHKITVAADMLVAQKH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgttttcgcaatctgttgcgctgtttcaatgcccaatttgccatatgtcgctc
catttgtcagggacaagtcttttatgcccgcaaaggcatacctttgatatggccaaacaa
ggctatgttaatctcctattgaatgctaaaaaagatcctcattacgacaaaaactccttt
atccagcgtagccggattctagaggctggcttttacagtcatattttagaggctcttaaa
gaagaactaaagtccaatcaacgtctaaccattctcgacgtcgcttgtggagaaggctac
tatgcacgcgcattgtccgaaaatccttcctaccaactattagccttcgacttatcaaag
gactccgtcttattagcagccaaaaaagacccccaaaagcgggtctcctggtttgtcgga
gacttagcaaaacttccccttgccgatgacagtgtcgatgtgattcttgacattttctca
cctgcaaactatcaggaatttcttcgggtgttaaagccgggcggcaaactgataaaaatg
gtcacagcaagtgaccaccttcaagagttgcgtgaggccgcagctgcgcaattacaatcc
aagacctattcaaatcaagccattgttgaccacttcgcagaagcttttcctgatttcaac
atgacgcatctcagccaaacttatccaatagaagataaggcattagctcattttgtccaa
atgacaccacttttctttaatgtcaacacaaaagcaattcccttggcctcaatccacaag
attacagtcgcagcagacatgttagtggctcaaaagcattaa

DBGET integrated database retrieval system