KEGG   Streptococcus uberis: SUB0287Help
Entry
SUB0287           CDS       T00849                                 

Definition
(GenBank) putative mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
sub  Streptococcus uberis
Pathway
sub00051  Fructose and mannose metabolism
sub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SUB0287
Enzymes [BR:sub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SUB0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sigma_1s
Motif
Other DBs
NCBI-ProteinID: CAR40827
UniProt: B9DTG2
Position
282762..283940
Genome map
AA seq 392 aa AA seqDB search
MKAVHFGAGNIGRGFIGNILHDSGYELLFVDMDKNLVQQIHNDREYEIQILDFDQDPIII
DNVDAILGNSTELVIEELVKADIITTSVGANNLKYLAQNMKNALLKRAELKTTVTVIANE
NTINATDILSEEIFNICSEAERDKILSITNFVNSAIDRQAMSKNYNGKSVALVEKYFEWV
IEKNDYTKEIEGIIASAKFVEDLEPYIERKLFLVNAEHAAFAYLGKLFGYKTVQSSADNK
DILNLVKRMTIENSRYFKTKYNMDPVELESFISKTLLRHTNPKFSDEVERVGRNPIRKLG
PRDRLISPFVKLTELSLPNICLTKVIAAALFFTDESDSESLQLQAMIAKEGVETVLEKIC
GLSEVLITQIMKEYNSIKSDPNNIFRGVVNDY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtacattttggagcgggaaatattggacgtggttttattgggaatatacta
catgatagtggttatgagttgttatttgtagatatggataaaaatctggttcaacaaatc
cataatgatagagaatacgaaattcaaatattagattttgatcaagatcccataatcatt
gataatgtagatgctatactcggtaattcgactgagttagtgatagaagaacttgtaaaa
gctgatattataacaacctcagttggtgcaaataatctcaaatatttagcgcaaaatatg
aaaaatgcacttttgaaaagggctgagttgaaaactaccgtcacagtcattgcaaatgaa
aatacaattaatgctacagatattctttctgaggaaatttttaatatttgtagtgaagct
gagagagataaaattttaagtattacaaattttgtaaactctgctatcgatagacaagca
atgtcgaaaaattataacggaaaatctgtagctctagttgaaaaatattttgaatgggtt
attgaaaagaatgattacactaaagaaattgaaggaatcatagcttctgcaaaatttgtt
gaggacttagaaccatatattgaaagaaaattgtttcttgttaatgcagaacatgcagca
tttgcctatttaggtaagctttttgggtataaaacagtccaatcaagtgcagataataaa
gatatcttaaatttagtgaagcgtatgaccattgaaaattctcgatactttaaaactaaa
tataatatggatccagtagaattagaatcatttattagtaagactttattgagacataca
aatcctaagttcagtgatgaggtggagcgtgttggaagaaatccaataagaaaactaggc
cctagagatagattaatttctccattcgttaaattaactgaattatcactaccaaatatt
tgtttaacaaaagtaattgctgctgcattattttttacagatgaatctgattcagaatcg
ttacaattacaagccatgattgctaaagaaggtgttgaaactgtactcgaaaaaatttgt
gggttatcggaggtcttaataactcaaataatgaaagagtataattctattaagagtgac
ccaaataacatttttagaggagtggtaaatgattattga

DBGET integrated database retrieval system