KEGG   Streptococcus uberis: SUB0317Help
Entry
SUB0317           CDS       T00849                                 

Gene name
truA
Definition
(GenBank) tRNA pseudouridine synthase A
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
sub  Streptococcus uberis
Brite
KEGG Orthology (KO) [BR:sub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sub03016]
    SUB0317 (truA)
Enzymes [BR:sub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     SUB0317 (truA)
Transfer RNA biogenesis [BR:sub03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    SUB0317 (truA)
 Prokaryotic type
    SUB0317 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1 DUF2344
Motif
Other DBs
NCBI-ProteinID: CAR40884
UniProt: B9DTJ0
Position
316002..316754
Genome map
AA seq 250 aa AA seqDB search
MTRYKAIISYDGSQFQGFQRQSHARSVQEEIEKTLTKLTNGKEIKVHGAGRTDSGVHAYG
QVLHFDLDQDRDLEKLRFALDTQSPEDIDFISVEKVSDDFHSRYTKHLKTYEFIVDIGRP
KNPMMRHYATHFPYPLDLDNIQLAIKDLIGTHDFTGFTASGATIENKVRTIIDASVRYEE
DKNFLIFTFTGNGFLYKQVRNMVGTLLKIGNNRMPVDQIKTILEKKDRQLAGPTPAGNGL
YLKEIIYEDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactagatataaagcaattatttcatatgacggcagtcaatttcaaggttttcaacgg
caatcccatgccagaagtgttcaagaggaaattgaaaaaacattaactaaattaacaaat
ggaaaagaaataaaagttcatggtgcaggaagaacggactctggtgttcatgcttatggt
caagttctacactttgatttagatcaggatcgtgatttggaaaaattgcgatttgctctg
gatacacaatctccagaggatattgattttattagtgttgagaaagtttctgatgatttt
cattctagatatactaagcatcttaaaacttatgagtttattgtagatattgggagacct
aaaaatccaatgatgcggcattatgcgacccattttccttatccattagatttggacaac
attcaattagcaataaaagacctgattggtacgcatgattttacaggttttacagcttct
ggggcgacgattgaaaataaggtaagaactattattgatgctagtgttagatatgaagag
gataagaacttcttaatcttcacctttactgggaatggttttttatataaacaagttcgt
aatatggtcggcacattattgaaaatcgggaataatagaatgcctgttgatcagattaaa
accattctggagaaaaaagatcgtcaactggctggtccaacgccagcaggaaatggcttg
tacttgaaggagattatttatgaagacaaataa

DBGET integrated database retrieval system