KEGG   Streptococcus uberis: SUB0730Help
Entry
SUB0730           CDS       T00849                                 

Definition
(GenBank) putative RNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sub  Streptococcus uberis
Brite
KEGG Orthology (KO) [BR:sub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sub03009]
    SUB0730
Enzymes [BR:sub01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SUB0730
Ribosome biogenesis [BR:sub03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SUB0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: CAR41656
UniProt: B9DU59
Position
705075..705965
Genome map
AA seq 296 aa AA seqDB search
MELIIKTGGARLDKALADLTDLSRSQANDEIKKGTVLVNGEPVKAKYTVKEGDIISYQLP
EEEILDYEAEDIPIEIVYEDEYLAIINKAQGMVVHPSAGHSSGTLVNALLYHIKDLSTIN
GVVRPGIVHRIDKDTSGLLMIAKNDKAHHILADELKAKKSLRKYLAIVHGNLPNDRGMIE
APIGRSEKDRKKQAVTAKGKDAITRFQVVERFGDFTLVELSLETGRTHQIRVHMAYIGHP
VAGDPLYGPRKTLAGNGQFLHAQTLGFTHPSTGEMVTFTAEPPIIFRQTLEKLRNR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaacttattataaagactggaggggctcgtttagacaaggctctcgctgacttgacg
gatttatccagaagtcaagcaaatgatgaaataaaaaaaggtactgttttagtaaacggt
gaaccagtaaaagctaaatacactgttaaggagggagatatcatcagttatcaacttcct
gaagaggaaatattggattatgaagctgaagatattccaattgaaattgtttatgaggat
gaatatttagctattatcaataaagctcaaggcatggttgttcacccatctgcaggtcat
agctctggtactttagttaatgcacttttgtatcatatcaaggatttatctactataaat
ggggtggtacgccctggaattgtccatcggattgataaagatacctcaggccttttaatg
attgccaaaaatgataaagcccatcatattttggcggacgaactaaaagccaaaaaatca
ttaaggaaatatctggccatagttcatggaaatctaccaaatgatcgtggaatgattgaa
gctccaattggtcgcagtgaaaaggaccgtaagaagcaggctgttactgcaaaaggaaaa
gatgccatcactaggtttcaagtggtggaacggtttggagattttacgcttgttgagtta
agtttagaaactggcagaacacatcaaatcagagtgcatatggcttatattgggcatcca
gttgcaggtgaccctttgtatggacctaggaagaccttagctggtaacggtcaattctta
catgctcaaaccctaggtttcacacatcctagtaccggtgaaatggttactttcacagcg
gaaccaccaatcatttttaggcagacacttgaaaagcttagaaatagatag

DBGET integrated database retrieval system