KEGG   Streptococcus uberis: SUB0849Help
Entry
SUB0849           CDS       T00849                                 

Definition
(GenBank) putative cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sub  Streptococcus uberis
Pathway
sub00730  Thiamine metabolism
sub01100  Metabolic pathways
sub04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SUB0849
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SUB0849
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sub03016]
    SUB0849
   03029 Mitochondrial biogenesis [BR:sub03029]
    SUB0849
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sub02048]
    SUB0849
Enzymes [BR:sub01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SUB0849
Transfer RNA biogenesis [BR:sub03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SUB0849
 Prokaryotic Type
    SUB0849
Mitochondrial biogenesis [BR:sub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SUB0849
Prokaryotic defense system [BR:sub02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SUB0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAR41892
UniProt: B9DS24
Position
complement(828771..829901)
Genome map
AA seq 376 aa AA seqDB search
MKNKASIYFDNAATTPLTDSVIEAMTTVMKDTFGNPSSIHAFGREANKLLRESRQDIAQL
LKVPARDIIFTSGGTESNNTAIKGYALANQNKGKHLITTAIEHHSVLHTMAYLEKTFHFE
VTYLTPKNGHISAEQVKEALREDTILVSIMAANNETGDLLPIAEIGELLRDHPAAFHVDA
VQLMGKRPIYPLELGIDFLSASAHKFHGPKGIGFLFSHSNHFDALLHGGDQEEKRRASTE
NLIGIIGMVRALKDAYAEMDNNWNKIEELSRQLLSQLEGIPFYLNKNQPSLPHVLNIGFP
NHQNGILLTRLDIDNIAISTGSACTAGTVEPSHVLEAFYGQGATQLDESVRISLSDQNSS
EEVIQVTDSIKKIIGG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagcttctatttactttgataatgctgctactacgcctctaacggattct
gttattgaagcgatgacaacagttatgaaagacacttttggaaatccctctagcattcat
gctttcggtcgggaagccaacaaacttttgagggaaagtcgtcaagatattgctcaatta
ttgaaagtacctgctagagatattatatttacctcaggtggtactgaaagtaataacacc
gctataaaaggctatgctttagcaaatcaaaacaagggaaaacaccttatcactacagct
attgaacaccattctgtccttcatactatggcttatcttgaaaaaacctttcatttcgaa
gtcacttatttgacacctaaaaatggacatatcagtgcagagcaagtaaaggaagcatta
cgtgaggataccatattagttagcattatggctgcaaacaacgaaacaggtgacttacta
ccgattgctgaaatcggagaattgttaagggatcatccagctgcttttcatgttgacgcg
gttcaattgatggggaaaagaccaatctatccattggagttaggaattgattttttatca
gcttcagctcataaattccacggtccaaaagggataggtttccttttctctcattcaaat
cactttgatgctctgcttcatggcggagaccaagaagaaaaaagacgcgctagcacagaa
aacttaattggtattattggaatggtcagagccttaaaagatgcatatgctgaaatggat
aataactggaacaagattgaggagttatctcgtcaactactgagtcagttagagggtatt
ccattttatcttaataaaaatcaaccatccttaccacatgtgctaaatattggttttcca
aaccatcaaaacggcatccttttaaccagattagacattgacaatattgctatttccact
ggttcggcatgtactgcagggaccgttgaacctagtcacgttttagaggctttctacggt
caaggagccactcaattagacgaatctgtaagaatttctctgtctgatcagaatagctct
gaagaagtcatccaagtgacagatagcattaagaaaattatcggaggataa

DBGET integrated database retrieval system