KEGG   Streptococcus uberis: SUB1804Help
Entry
SUB1804           CDS       T00849                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sub  Streptococcus uberis
Pathway
sub00071  Fatty acid degradation
sub00072  Synthesis and degradation of ketone bodies
sub00280  Valine, leucine and isoleucine degradation
sub00310  Lysine degradation
sub00362  Benzoate degradation
sub00380  Tryptophan metabolism
sub00620  Pyruvate metabolism
sub00630  Glyoxylate and dicarboxylate metabolism
sub00640  Propanoate metabolism
sub00650  Butanoate metabolism
sub00900  Terpenoid backbone biosynthesis
sub01100  Metabolic pathways
sub01110  Biosynthesis of secondary metabolites
sub01120  Microbial metabolism in diverse environments
sub01130  Biosynthesis of antibiotics
sub01200  Carbon metabolism
sub01212  Fatty acid metabolism
sub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SUB1804 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    SUB1804 (thlA)
   00640 Propanoate metabolism
    SUB1804 (thlA)
   00650 Butanoate metabolism
    SUB1804 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SUB1804 (thlA)
   00072 Synthesis and degradation of ketone bodies
    SUB1804 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SUB1804 (thlA)
   00310 Lysine degradation
    SUB1804 (thlA)
   00380 Tryptophan metabolism
    SUB1804 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUB1804 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SUB1804 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SUB1804 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sub04147]
    SUB1804 (thlA)
Enzymes [BR:sub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SUB1804 (thlA)
Exosome [BR:sub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUB1804 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CAR43826
UniProt: B9DW90
Position
complement(1795067..1796317)
Genome map
AA seq 416 aa AA seqDB search
MLTTKQEEIVIVGAARTPVGAYLGDLKTVPVEVLGEVALKEAVNRANLSVEDIDEVIVGH
VTGSQTTNNLGNIIAINSGLKDTSTGMTVNRICGSGIQSAVSASLELLHSNKKIIAAGGA
ESLSRAPYQLPDSARYQAFRMGDVQMIDANLEGHRSASGRNSGIAHMGNTAENVVRKYNI
SREKQDQFAFESQQKAAEAISNGRFAQEIVPVEVPGRKGQVTIVEKDGHPRPDTTMESLA
KLRPAFEKDGTVTAGNASGLNDGAAFEIFTTESLAKEKGLEIMAKVVDYQISGCAPETMG
LGPVYAINDLLERQGLDLVKDIDVLEINEAFAGQTIGCLMELGIDMDTDFYKHKFNPHGG
AVALGHPLGMSGARIITSLLYEFKNNPDKRYAIASACIGGGQGIALLLENGYYTGK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttaactacaaaacaagaagaaatcgttatcgttggtgccgcaagaactcctgttgga
gcatatcttggtgatttgaaaacagttccggttgaagtattaggtgaagttgctttaaaa
gaagctgttaaccgtgctaacttatcagttgaggatattgatgaggttatcgttggacat
gttactggatcacaaacaacaaacaacttgggtaatattattgccattaatagtggattg
aaagatacatcgacagggatgactgttaaccgcatttgtggttcaggtattcaatcagca
gtatcagcatcattagaacttcttcactctaacaagaagattattgctgcgggtggtgca
gaatcattatcacgcgctccttatcaattgcctgatagcgctcgttaccaagcttttcgt
atgggagatgtccaaatgattgatgccaacttagaagggcaccgttcagcatcaggacgt
aattcaggaattgctcatatgggaaatacagcagaaaatgttgttcgtaaatacaatatt
tctcgtgaaaaacaagatcaatttgcttttgaatcacaacaaaaagcagctgaagctata
tcaaatggtcgtttcgctcaagaaattgttccagttgaagttccaggacgtaaagggcaa
gtaactattgttgaaaaagatggacatcctcgtcctgatacgacaatggaaagtcttgct
aaacttcgtccagcctttgaaaaagatggcactgtaacagcaggaaatgcctcaggccta
aatgatggtgctgcatttgaaattttcacaacagaatcattagctaaagaaaaaggcctt
gaaataatggccaaagtagtggattatcaaatttctggctgtgctcctgaaaccatggga
cttggaccagtatatgcaatcaacgacttattagaacgtcaagggcttgacttagtaaaa
gatattgatgttcttgaaattaatgaagcctttgctggtcaaacaataggatgtttaatg
gaacttggtattgatatggatactgacttctacaaacataaatttaatccacatggtggc
gcagttgctctaggacacccacttggtatgtctggtgcacgtattattacgtcactatta
tacgaattcaagaataaccctgataaacgctatgccattgcctcagcatgtatcggtggt
ggacaaggaattgctttacttctagaaaatggctattacactggtaaataa

DBGET integrated database retrieval system