KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_529Help
Entry
ECTR2_529         CDS       T01887                                 

Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Pathway
suc00071  Fatty acid degradation
suc00072  Synthesis and degradation of ketone bodies
suc00280  Valine, leucine and isoleucine degradation
suc00310  Lysine degradation
suc00362  Benzoate degradation
suc00380  Tryptophan metabolism
suc00620  Pyruvate metabolism
suc00630  Glyoxylate and dicarboxylate metabolism
suc00640  Propanoate metabolism
suc00650  Butanoate metabolism
suc00900  Terpenoid backbone biosynthesis
suc01100  Metabolic pathways
suc01110  Biosynthesis of secondary metabolites
suc01120  Microbial metabolism in diverse environments
suc01130  Biosynthesis of antibiotics
suc01200  Carbon metabolism
suc01212  Fatty acid metabolism
suc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECTR2_529
   00630 Glyoxylate and dicarboxylate metabolism
    ECTR2_529
   00640 Propanoate metabolism
    ECTR2_529
   00650 Butanoate metabolism
    ECTR2_529
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECTR2_529
   00072 Synthesis and degradation of ketone bodies
    ECTR2_529
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECTR2_529
   00310 Lysine degradation
    ECTR2_529
   00380 Tryptophan metabolism
    ECTR2_529
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECTR2_529
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECTR2_529
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECTR2_529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suc04147]
    ECTR2_529
Enzymes [BR:suc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECTR2_529
Exosome [BR:suc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECTR2_529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBX33913
Position
594096..595235
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system