KEGG   Staphylococcus aureus subsp. aureus ECT-R 2: ECTR2_615Help
Entry
ECTR2_615         CDS       T01887                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
suc  Staphylococcus aureus subsp. aureus ECT-R 2
Brite
KEGG Orthology (KO) [BR:suc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ECTR2_615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CBX33999
Position
679472..680479
Genome map
AA seq 335 aa AA seqDB search
MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTAILMAAVMNFIGALTF
TGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIPSSSSHALIGSIAGAAI
ASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIFKNANLTRANRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLWVKFACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMIITWVITLPISALLAGLLFYILNLFF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatataatcatcgtcactatagctgtagttattttctcgctgatatttgacttt
atcaatggattccatgatacagccaatgcagtagctactgctgtatctactagagcgtta
acgcctaaaacggcaattttaatggcagcagtgatgaactttataggtgctttaacattt
acgggcgttgcaggcaccattactaaagacattgtcgatccatttaaattggaaaatgga
ttagttgttgtgttagctgcaatacttgcggctattatttggaatttagctacttggttt
tacggaattccaagttcgtcttcacatgcacttataggttcaattgcgggtgcagcaatc
gcatctgaaggctcatttggagtgttacattaccaaggtttcacaaaaattattattgta
ttaatcgtttcaccgataatcgcattttgtgttggtttcttgatgtattcaatttttaaa
gttatctttaaaaatgcaaatttaacaagagcgaatcgtaactttagatttttccaaatt
ttcacggcagcgttacaatcattctctcacggtacgaatgatgcgcaaaaatcaatgggt
attattacgttggcattgattgtcgctaatgtacagaatgatggcagtgttgaaccacag
ttatgggtaaaatttgcctgtgcgacagcaatggggcttggtactgcaattggtggctgg
aaaattatcaaaactgtaggtggtaatattatgaaaatacgtccagcaaatggtgctgcg
gccgatttatcatctgcattaacaatttttgttgcatcatcgctacatttcccattatca
acaactcacgttgtgtcatcatcaatcttaggtgttggtgcttctaaccgagctaaaggt
gtaaaatggagcactgcgcaacgaatgatcattacatgggtgattacattacctatttca
gcattgttagcaggtttactattctatatacttaacttatttttctaa

DBGET integrated database retrieval system