KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0434Help
Entry
ST398NM01_0434    CDS       T02043                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00071  Fatty acid degradation
sud00072  Synthesis and degradation of ketone bodies
sud00280  Valine, leucine and isoleucine degradation
sud00310  Lysine degradation
sud00362  Benzoate degradation
sud00380  Tryptophan metabolism
sud00620  Pyruvate metabolism
sud00630  Glyoxylate and dicarboxylate metabolism
sud00640  Propanoate metabolism
sud00650  Butanoate metabolism
sud00900  Terpenoid backbone biosynthesis
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
sud01212  Fatty acid metabolism
sud02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ST398NM01_0434
   00630 Glyoxylate and dicarboxylate metabolism
    ST398NM01_0434
   00640 Propanoate metabolism
    ST398NM01_0434
   00650 Butanoate metabolism
    ST398NM01_0434
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ST398NM01_0434
   00072 Synthesis and degradation of ketone bodies
    ST398NM01_0434
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ST398NM01_0434
   00310 Lysine degradation
    ST398NM01_0434
   00380 Tryptophan metabolism
    ST398NM01_0434
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ST398NM01_0434
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ST398NM01_0434
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ST398NM01_0434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sud04147]
    ST398NM01_0434
Enzymes [BR:sud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ST398NM01_0434
Exosome [BR:sud04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ST398NM01_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFH68674
UniProt: A0A0E0VLS9
Position
347651..348832
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPAIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPSEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcagtcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatcctgctattatgggtattgccccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattaccttctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaaatataaataa

DBGET integrated database retrieval system