KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_0556Help
Entry
ST398NM01_0556    CDS       T02043                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Pathway
sud00450  Selenocompound metabolism
sud00970  Aminoacyl-tRNA biosynthesis
sud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sud00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ST398NM01_0556
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ST398NM01_0556
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sud01007]
    ST398NM01_0556
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sud03016]
    ST398NM01_0556
Enzymes [BR:sud01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ST398NM01_0556
Amino acid related enzymes [BR:sud01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ST398NM01_0556
Transfer RNA biogenesis [BR:sud03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ST398NM01_0556
 Prokaryotic type
   Other AARSs
    ST398NM01_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d ARL2_Bind_BART PilM
Motif
Other DBs
NCBI-ProteinID: AFH68786
UniProt: A0A0E0VMS1
Structure
PDB: 

Position
462312..464285
Genome map
AA seq 657 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYL
GEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHQVELVKEESYFFNISKYTDR
LLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDA
LVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDL
ANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVA
LSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPK
EIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRLDSEAEIAYIKESMQPPAT
EEEKEEIPSKPQIDIKDFDKVEIKAATIIDAEHVKKSDKLLKIQVDLDSEQRQIVSGIAK
FYTPDDIIGKKVAIVTNLKPAKLMGQKSEGMILSAEKDGVLTLVSLPSAIPNGAVIK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacattttatataacaaccccaatatactatcctagtgggaatttacat
ataggacatgcatattctacagtggctggagatgttattgcaagatataagagaatgcaa
ggatatgatgttcgttatttgactggaacggatgaacacggtcaaaaaattcaagaaaaa
gctcaaaaagctggtaagacagaaattgaatatttggatgagatgattgctggaattaaa
caattgtgggctaagcttgaaatttcaaatgatgattttatcagaacaactgaagaacgt
cataaacatgtcgttgagcaagtatttgaacgtttattaaagcaaggtgatatctattta
ggtgaatatgaaggttggtattctgttccggatgaaacatactatacagagtcacaatta
gtagacccacaatacgaaaacggtaaaattattggtggtaaaagtccagattctggacac
caagttgaactagtaaaagaagaaagttatttctttaatattagtaaatatacagaccgt
ttattagagttctatgaccaaaatccagattttatacaaccaccatcaagaaaaaatgaa
atgattaacaacttcattaaaccaggacttgctgatttggctgtttctcgtacatcattt
aactggggtgtccatgttccgtctaatccaaaacatgttgtttatgtttggattgatgcg
ttagttaactatatttcagcattaggctatttatcagatgatgagtcactatttaacaaa
tactggccagcagatattcatttaatggctaaggaaattgtgcgattccactcaattatt
tggcctattttattgatggcattagacttaccgttacctaaaaaagtctttgcacatggt
tggattttgatgaaagatggaaaaatgagtaaatctaaaggtaatgtcgtagaccctaat
attttaattgatcgctatggtttagatgccacacgttattatctaatgcgtgaattacca
tttggttcagatggcgtatttacacctgaagcatttgttgagcgtacaaatttcgatcta
gcaaatgacttaggtaacttagtaaaccgtacgatttctatgattaataagtactttgat
ggcgaattaccagcgtatcaaggtccacttcatgaattagatgaagaaatggaagctatg
gctttagaaacagtgaaaagctatactgaaagcatggaaagtttgcaattttctgtggca
ttatctacggtatggaagtttattagtagaacgaataagtatattgacgaaacaacgcct
tgggtattagctaaggacgatagccaaaaagatatgttaggcaatgttatggctcactta
gttgaaaatattcgttatgcagctgtattattacgtccattcttaactcatgcgccgaaa
gagatttttgaacaattgaacattaacaatcctcaatttatggaatttagtagtttagag
caatatggtgtgcttactgagccaattatggttactgggcaacctaaacctattttccca
agattggatagcgaagcggaaattgcatatatcaaagaatcaatgcaaccgcctgctact
gaagaggaaaaagaagagattcctagcaaacctcaaattgatattaaagactttgataaa
gttgaaattaaggcagcaacgattattgatgctgaacatgttaagaagtcagataagctt
ttaaaaattcaagtagacttagattctgaacaaagacaaatcgtatcaggaattgccaaa
ttctatacaccagatgatattattggtaaaaaagtagcaattgttactaacttgaaacca
gctaaattaatgggacaaaaatctgaaggtatgatattatctgctgaaaaagatggtgta
ttaaccttagtaagtttaccaagtgcaattccaaatggtgcagtgattaaataa

DBGET integrated database retrieval system