KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_0853Help
Entry
ST398NM01_0853    CDS       T02043                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00010  Glycolysis / Gluconeogenesis
sud00051  Fructose and mannose metabolism
sud00562  Inositol phosphate metabolism
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
sud01230  Biosynthesis of amino acids
Module
sud_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sud_M00002  Glycolysis, core module involving three-carbon compounds
sud_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_0853
   00051 Fructose and mannose metabolism
    ST398NM01_0853
   00562 Inositol phosphate metabolism
    ST398NM01_0853
Enzymes [BR:sud01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ST398NM01_0853
Exosome [BR:sud04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ST398NM01_0853
  Exosomal proteins of bladder cancer cells
   ST398NM01_0853
  Exosomal proteins of melanoma cells
   ST398NM01_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFH69085
UniProt: A0A0E0VM66
Structure
PDB: 

Position
783642..784502
Genome map
AA seq 286 aa AA seqDB search
MACLFNIVTGKQSQDDIVFHHFSKIFTKQGVSLMRTPIIAGNWKMNKTVQEAKDFVNALP
TLPDSKEVESVICAPAIQLDALTTAVKEGKAQGLEIGAQNTYFEDNGAFTGETSPVALAD
LGVKYVVIGHSERRELFHETDEEINKKAHAIFKHGMTPIICVGETDEERESGKANDVVGE
QVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSSTSEDANEMCAFVRQTIADLSSKEVSEA
TRIQYGGSVKPNNIKEYMAQTDIDGALVGGASLKVEDFVQLLEGAK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtggcatgtttgtttaacattgttacgggaaaacagtcacaagatgacatcgtgtttcat
cacttttcaaaaatatttacaaaacaaggagtgtctttaatgagaacaccaattatagct
ggtaactggaaaatgaacaaaacagtacaagaagcaaaagacttcgtcaatgcattgcca
acattaccagattcaaaagaagtagaatcagtaatttgtgcaccagcaattcaattagat
gcattaactactgcagttaaagaaggaaaagcacaaggtttagaaatcggtgctcaaaat
acgtatttcgaagataatggtgcgttcacaggtgaaacgtctccagttgcattagcagat
ttaggcgttaaatacgttgttatcggccattctgaacgtcgtgaattattccacgaaaca
gatgaagaaattaacaaaaaagcgcatgctattttcaaacatggtatgacaccaattatt
tgtgttggtgaaacagatgaagagcgtgaaagtggtaaagctaacgatgttgtaggtgag
caagttaagaaagctgttgcaggtttatctgaagagcaacttaaatcagttgtaattgct
tatgaaccaatctgggcaatcggaactggtaaatcatcaacatctgaagatgcgaatgaa
atgtgtgcatttgtacgtcaaactattgctgacttatcaagcaaagaagtatcagaagca
actcgtattcaatatggtggtagtgttaaacctaacaacattaaagaatacatggcacaa
actgatattgatggggcattagtaggtggcgcatcacttaaagttgaagatttcgtacaa
ttgttagaaggtgcaaaataa

DBGET integrated database retrieval system