KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_1194Help
Entry
ST398NM01_1194    CDS       T02043                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Brite
KEGG Orthology (KO) [BR:sud00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sud03009]
    ST398NM01_1194
Enzymes [BR:sud01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     ST398NM01_1194
Ribosome biogenesis [BR:sud03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ST398NM01_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AFH69415
UniProt: A0A0E0VN78
Position
1112365..1113282
Genome map
AA seq 305 aa AA seqDB search
METYEFNITDKEQTGMRVDKLLPELNSDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLND
HIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQI
KNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIP
HDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVH
MKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTI
RKRDA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagacttatgaatttaacattacagataaagaacaaacaggtatgcgtgtagataag
ttgctgcctgaattaaatagtgattggtctcgtaaccagatacaagattggattaaagca
ggtttagtcgttgcaaacgataaagttgttaaatctaattataaagtgaaacttaatgat
catatagttgtcactgaaaaagaagtggttgaagctgatattctacctgaaaatttaaat
ttagatatttattatgaagatgacgatgttgcagttgtatataaaccgaaaggcatggta
gttcatccatcaccaggtcattataccaatacattagttaatggtttaatgtatcaaatt
aaaaatttgtcgggtattaatggagaaattcgtccaggtattgttcaccgtatagatatg
gatacttctggtttattaatggttgctaaaaatgatattgctcatcgtggacttgtagaa
caattaatggataaatctgttaaaagaaaatatatcgctttagttcacgggaatattcct
catgattacggtacaatcgatgcgccaattggtagaaacaaaaatgatcgtcaatctatg
gctgttgttgatgatggtaaggaagcagtgacacattttaacgtactagaacattttaaa
gattatacgcttgttgaatgtcaacttgaaacaggacgtacgcatcaaatccgtgtgcac
atgaaatatattggcttcccattagttggtgatccaaagtatggaccgaaaaagacattg
gatattggtggtcaagctctacatgctggacttattggattcgaacatccagtaacaggt
gaatatattgaaagacatgctgaattaccacaagactttgaagatttattagatacaata
agaaaaagagatgcataa

DBGET integrated database retrieval system