KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1207Help
Entry
ST398NM01_1207    CDS       T02043                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00230  Purine metabolism
sud01100  Metabolic pathways
Module
sud_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ST398NM01_1207
Enzymes [BR:sud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ST398NM01_1207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_16 AAA_22 AAA_17 ABC_tran RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFH69428
UniProt: A0A0E0VQ09
Structure
PDB: 

Position
1126932..1127555
Genome map
AA seq 207 aa AA seqDB search
MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
FIFLAPPSLDHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
QCIVEAEHLKRERVEAKYRKMILEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggataatgaaaaaggattgttaatcgttttatcaggaccatctggagtaggtaaaggt
actgttagaaaacgaatatttgaagatccaagtacatcatataagtattctatttcaatg
acaacacgtcaaatgcgtgaaggtgaagttgatggcgtagattacttttttaaaactagg
gatgcgtttgaagctttaattaaagatgaccaatttatagaatatgctgaatatgtaggc
aactattatggtacaccagttcaatatgttaaagatacaatggacgaaggtcatgatgta
tttttagaaattgaagtagaaggtgcaaagcaagttagaaagaaatttccagatgcgtta
tttattttcttagcacctccaagtttagatcacttgagagagcgattagtaggtagagga
acagaatctgatgagaaaatacaaagtcgtattaacgaagcacgtaaagaagtcgaaatg
atgaatttatacgattacgttgtagttaatgatgaagtagaacttgcgaagaatagaatt
caatgtattgtagaagctgagcacttaaaaagagagcgcgtagaagctaagtatagaaaa
atgattttggaggctaaaaaataa

DBGET integrated database retrieval system