KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_1764Help
Entry
ST398NM01_1764    CDS       T02043                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Pathway
sud00430  Taurine and hypotaurine metabolism
sud00620  Pyruvate metabolism
sud00640  Propanoate metabolism
sud00680  Methane metabolism
sud01100  Metabolic pathways
sud01120  Microbial metabolism in diverse environments
sud01200  Carbon metabolism
Module
sud_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ST398NM01_1764
   00640 Propanoate metabolism
    ST398NM01_1764
  09102 Energy metabolism
   00680 Methane metabolism
    ST398NM01_1764
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ST398NM01_1764
Enzymes [BR:sud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ST398NM01_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AFH69942
UniProt: A0A0E0VPW6
Position
complement(1680526..1681728)
Genome map
AA seq 400 aa AA seqDB search
MSKLILAINAGSSSLKFQLIRMPEEELVTKGLVERIGLKDSIFTIEVDGEKVKTVQDIKD
HVEAVDIMLDAFKKHNIINDINDIDGTGHRVVHGGEKFPESAAITDEVEKEIEELSELAP
LHNPANLMGIRAFRKLLPNIPHVAIFDTAFHQTMPEKAYLYSLPYHYYKDYGIRKYGFHG
TSHKFVSQRAAEMLDKPIEDLRIISCHIGNGASIAAIDGGKSIDTSMGFTPLAGVTMGTR
SGNIDPALIPFIMEKTGKTAEQVLEILNKESGLLGLSGTSSDLRDLSEEAESGKARSQMA
LDVFASKIHKYIGSYAARMHGVDVIVFTAGIGENSVEIRAKVLEGLEFMGVYWDPKKNEN
LQRGKEGFINYPHSPVKVVVIPTDEESMIARDVMTYGGLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattaatcttggctatcaacgctggtagttcatcattaaagtttcaattaatc
agaatgcctgaagaggaattagtaacaaagggattagtagaaagaatcggattaaaagat
tcaatttttacaattgaagtagacggggaaaaagttaaaacagtacaagatatcaaggat
catgttgaagcagttgatatcatgttagacgcatttaaaaaacataatatcattaatgat
attaacgatatcgatggaactggtcaccgtgttgtacatggtggtgaaaaattccctgaa
tcagcagcaattactgatgaagttgaaaaagaaattgaagaattaagcgaattagcaccg
cttcacaacccagctaacttaatgggtattcgtgctttccgtaaattattaccgaatatc
cctcatgtggcgatttttgatacagcattccatcaaacaatgcctgaaaaagcatattta
tatagcttgccatatcattattataaagattacggtattcgtaagtatggcttccatggt
acaagtcataaatttgtgtcacaaagagcggcagaaatgttagataaaccaattgaagat
ttacgcattatctcttgtcatattggtaacggtgcatcaatcgcagctatcgatggcggt
aaatcaattgatacatcaatgggcttcacaccacttgcaggtgtaacaatgggtacgcgt
tcaggtaatattgaccctgctttaattccatttattatggaaaaaactggcaaaactgct
gaacaagtattagaaatcttaaacaaagaatctggtttattaggattatcaggtacatca
agtgatttacgtgacttatctgaagaagctgaatcaggcaaagcacgttctcaaatggct
ttagatgtctttgcttctaaaatccacaaatatattggatcatacgctgcaagaatgcat
ggcgttgatgtaatcgtatttactgcaggtattggtgaaaattcagtggaaattcgtgca
aaagttcttgaaggtttagaatttatgggagtttactgggatcctaagaaaaatgaaaac
ttacaacgtggtaaagaaggatttattaactatccgcattcacctgttaaagttgtcgtt
ataccgactgacgaagaaagtatgattgctcgtgatgttatgacatacggtggtctaaaa
taa

DBGET integrated database retrieval system