KEGG   Staphylococcus aureus subsp. aureus 71193: ST398NM01_1785Help
Entry
ST398NM01_1785    CDS       T02043                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sud  Staphylococcus aureus subsp. aureus 71193
Pathway
sud00010  Glycolysis / Gluconeogenesis
sud00620  Pyruvate metabolism
sud00640  Propanoate metabolism
sud00680  Methane metabolism
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sud00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST398NM01_1785
   00620 Pyruvate metabolism
    ST398NM01_1785
   00640 Propanoate metabolism
    ST398NM01_1785
  Energy metabolism
   00680 Methane metabolism
    ST398NM01_1785
Enzymes [BR:sud01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST398NM01_1785
Lipid biosynthesis proteins [BR:sud01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST398NM01_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFH69963
UniProt: A0A0E0VRM3
Position
complement(1707505..1709211)
Genome map
AA seq 568 aa AA seqDB search
MKVEVYKGAQGKHNLKDYEETYNTFDWKDVEQAFSWSETGKMNMAYECIDRHVDQGLGDK
IALNYKDEHRKESYTYKDMQRLSNKAANVLSEHAEVDKGDRVFIFMSRTPELYFALLGVL
KIGAIVGPLFEAFMEKAVADRLENSEAKVLITNKALLPRVPVDKLPNLKKIVVVDEDVED
NYIDFISLMETASDEFDIEWLKSDDGLILHYTSGSTGQPKGVLHVQQAMLVHYISGKYVL
DLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNCIAGGRFSPEQWYSMIEDFKVTIWYT
APTALRMLMSAGDDIVEKYDLSSLRSILSVGEPLNPEVIKWAKKVYGLTVLDTWWMTETG
GHMIVNYPTMDVKLGSMGKPLPGIQAAIIDDAGNELPPNRMGNLAIKKGWPSMMYRIWKN
PEKYKSYFIGDWYVSGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGIIGKPDPVRGEIIKAFVALRKGYEPTDELKEEIRLFVKEGLSAHAAPREIEFKDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTME
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaagtttataaaggagcgcaaggcaaacataaccttaaagattatgaagaa
acatataatacttttgattggaaagacgtagaacaagcattttcttggagtgaaactgga
aaaatgaacatggcatatgaatgtatagatcgccatgtagatcaaggattaggggataaa
atagcgttaaattacaaagatgagcacagaaaagaatcgtatacttataaagatatgcag
cggttatctaataaagcagcgaatgttttgtctgaacatgcagaagttgacaaaggtgac
agagtatttatatttatgtcacgtacacctgaactatattttgcgttgttaggtgtttta
aaaattggtgcaattgttgggccgttatttgaagcatttatggaaaaggcggttgcggat
agattagagaacagtgaagctaaagtgttaattactaataaggcattgttacctcgagta
cctgtagataaattaccgaacttgaaaaaaattgtagtcgtagatgaggatgtagaagac
aattacatagacttcattagtttgatggaaactgctagcgatgaatttgacattgaatgg
ttaaagtcggatgatggtttgattttacattatacatcaggttctactgggcaacctaaa
ggtgtattgcatgttcaacaagcgatgttagtgcactatatttctggaaaatatgtatta
gatttacaagaagatgatgtttattggtgtacagcagatccaggttgggttacaggaaca
tcttatggtatttttgcaccatggttaaatggcgctacaaattgtatagctggtggtcgc
ttttcaccagaacagtggtatagtatgattgaagattttaaagtgacgatttggtatacg
gcaccaacagctttaagaatgttaatgagtgctggtgacgatattgttgagaaatatgac
ttgtcatcgttacgttcgattctatcagtaggtgagcctttaaatcctgaagttataaaa
tgggcgaaaaaagtatacggtttaacggtgttagatacttggtggatgacagaaacaggt
ggacatatgattgttaactatccaacgatggacgtcaagcttggctcaatgggcaaacca
ttacctggtattcaagctgcaattatcgatgatgcaggtaatgaattaccaccaaatcga
atgggcaaccttgctataaaaaaaggctggccatctatgatgtatcgtatctggaagaat
ccagaaaaatataagtcatattttattggggactggtatgtatctggtgattcggcatat
aaagatgaagatggttacttttggttccaaggacgtgttgatgatgtaattatgacagct
ggcgaacgagttgggccatttgaggttgagtctaaattggttgaacacgaagcagttgcc
gaagcaggaattattggtaaacctgatccggttcgcggtgaaataattaaggcgtttgtt
gcactgagaaaaggatatgaaccaacagacgaattaaaagaagaaattcgtttatttgtt
aaagaaggtttgtcggcgcatgcagcaccacgtgaaatcgaatttaaagataaattacct
aaaacacgctcaggtaaaattatgagacgtgtattaaaagcttgggaattaaatttagat
gcaggggatttaagtacaatggaataa

DBGET integrated database retrieval system