KEGG   Staphylococcus aureus subsp. aureus 71193 (MSSA): ST398NM01_2418Help
Entry
ST398NM01_2418    CDS       T02043                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sud  Staphylococcus aureus subsp. aureus 71193 (MSSA)
Pathway
sud00020  Citrate cycle (TCA cycle)
sud00620  Pyruvate metabolism
sud01100  Metabolic pathways
sud01110  Biosynthesis of secondary metabolites
sud01120  Microbial metabolism in diverse environments
sud01130  Biosynthesis of antibiotics
sud01200  Carbon metabolism
Module
sud_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sud_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ST398NM01_2418
   00620 Pyruvate metabolism
    ST398NM01_2418
Enzymes [BR:sud01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ST398NM01_2418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFH70623
UniProt: A0A0E0VTK7
Position
complement(2334322..2335890)
Genome map
AA seq 522 aa AA seqDB search
MRHLLIQSGINMSYFSNVPLFILKRGTVFVMTTQHSKTDVILIGGGIMSATLGTLLKELS
PEKNIKVFEKLAQPGEESSNVWNNAGTGHSALCELNYTKEGKDGTVDCSKAIKINEQYQI
SKQFWAYLVKTGQLDNPDRFIQAVPHMSFVIGEDNVAFIKSRVATLKKNVLFEKMKLSQD
EEEMKSWVPLMIEGRKSDEPIALTYDETGTDVNFGALTAKLFDNLEQRGVEIQYKQNVLD
IKKQKSGAWLVKVKDLETNETTTYESDFVFIGAGGASLPLLQKTGIKQSKHIGGFPVSGL
FLRCTNQEVIDRHHAKVYGKAAVGAPPMSVPHLDTRFVDGKRSLLFGPFAGFSPKFLKTG
SHMDLIKSVKPNNIVTMLSAGIKEMSLTKYLVSQLMLSNDERMDDLRVFFPNAKNEDWEV
ITAGQRVQVIKDTEDSKGNLQFGTEVITSDDGTLAALLGASPGASTAVDIMFDVLQRCYR
DEFKGWEPKIKEMVPSFGYRLTDHEDLYHKINEEVTKYLQVK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttgagacacttattgattcaaagtggtattaatatgtcgtatttctcgaacgttccatta
ttcattttaaaaagggggactgtatttgttatgacaacacaacatagcaaaacagatgtc
atcttaattggtggcggtattatgagtgcaacattaggaacattacttaaagaattatca
cctgagaaaaatattaaagtgtttgaaaaattagcacaacctggcgaagagagttcaaat
gtatggaataatgctggtacagggcattcagcactttgcgagttgaactatacaaaagaa
ggtaaggatggcacagttgattgtagtaaagcaattaagataaatgagcagtaccaaatt
tcaaagcagttttgggcatatttagttaaaacaggacaattagataacccagatcgcttt
attcaagcggtgccacacatgagttttgtcattggcgaagataacgtagcttttataaaa
agtcgtgttgcaacgttaaagaaaaatgttttattcgaaaaaatgaaattatcgcaagat
gaagaagaaatgaaatcttgggtaccgttaatgattgaagggcgtaagtctgatgaacca
attgctttaacttatgatgaaactggtacagatgttaactttggtgcgttaactgcaaag
ttatttgataatttagaacaacgtggtgtggaaattcaatataagcaaaatgtattagac
atcaagaaacagaaatctggagcatggctagttaaagttaaagatttagaaactaacgaa
acgacaacatatgaatctgattttgtatttattggtgctggcggtgcgagtttaccatta
ctccaaaagactggaattaaacaatcaaaacatattggtggtttcccggtaagtggatta
ttcctgcgctgtacaaatcaagaagttattgatcgtcatcatgctaaagtgtacggaaaa
gcagcagtgggtgcgccaccaatgtcagtgccacacttagatacacgttttgtagacggc
aagcgttcattgttatttggtccatttgcaggtttctcacctaaatttttaaaaacaggt
tcacatatggatttaattaaatcggttaaaccaaataatatcgtgacgatgttatctgca
ggtatcaaagaaatgagtcttacgaagtatttagtgtcacaattgatgttatctaatgat
gagcgtatggatgatttaagagtctttttcccaaatgctaaaaatgaagattgggaagtg
attacagcagggcaacgtgtccaagtaatcaaggatacggaggattctaaaggtaactta
caatttggtaccgaagtcattacgtcagatgatggcacattagctgcattacttggtgca
tcacctggtgcgtcaacagctgtagatattatgtttgatgttttacagcgatgctatcgt
gatgaattcaaaggatgggaaccaaagattaaagaaatggtgccgtcatttggttatcgc
ttaacagatcatgaggatttatatcacaaaattaatgaagaagtaactaagtatttacaa
gttaaataa

DBGET integrated database retrieval system