KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_0536Help
Entry
SAOV_0536         CDS       T01869                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00790  Folate biosynthesis
sue01100  Metabolic pathways
Module
sue_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAOV_0536 (folP)
Enzymes [BR:sue01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SAOV_0536 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Pox_P35
Motif
Other DBs
NCBI-ProteinID: ADI97066
Structure
PDB: 

Position
557508..558311
Genome map
AA seq 267 aa AA seqDB search
MTKTKIMGILNVTPDSFSDGGKFNNVESAVTRVKAMMDEGADIIDVGGVSTRPGHEMISL
EEELNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDIINDQWAGLYDHRMFQVVAK
YDAEIVLMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNKIWLDPGIGFAKTRNEEA
EVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEVTAATTAYGIMKGVRAVRV
HNVELNAKLAKGIDFLKENENARHNLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaaaaattatgggcatattaaacgtcacacctgattcattctcagatggt
ggaaaatttaataatgttgaatcagcagtaactagagtgaaagcgatgatggatgaaggt
gctgacattatagatgttggaggtgtttcaacgagacccggccatgaaatgatttcatta
gaagaagagctgaacagagtattacctgttgttgaagctattgtcggttttgatgtaaaa
atttcggttgatacttttcgtagtgaagttgctgaagcttgtttaaagctaggtgttgat
attattaatgatcaatgggcaggcctttatgatcatcgcatgtttcaagttgtagccaaa
tacgatgcggaaattgttttaatgcataatggcaatggtaatcgtgatgaaccggttgtc
gaagaaatgttaacatctttgttagcacaagcacatcaagctaaaatagctggtatacct
tcaaataaaatttggctagatccaggtataggtttcgctaaaactagaaatgaagaagcc
gaagttatggcaagactggatgaacttgttgcaacagaatatccagttttattagcgact
agccggaaacgtttcactaaagagatgatgggttatgatacaacaccggttgaaagagat
gaagtaactgcagctacgactgcatatggtattatgaaaggcgttagagcggtacgcgtt
cataatgtcgagttgaatgctaaattagctaaaggtatagattttttaaaggagaatgaa
aatgcaagacacaatctttcttaa

DBGET integrated database retrieval system