KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_0610Help
Entry
SAOV_0610         CDS       T01869                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00071  Fatty acid degradation
sue00072  Synthesis and degradation of ketone bodies
sue00280  Valine, leucine and isoleucine degradation
sue00310  Lysine degradation
sue00362  Benzoate degradation
sue00380  Tryptophan metabolism
sue00620  Pyruvate metabolism
sue00630  Glyoxylate and dicarboxylate metabolism
sue00640  Propanoate metabolism
sue00650  Butanoate metabolism
sue00900  Terpenoid backbone biosynthesis
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01120  Microbial metabolism in diverse environments
sue01130  Biosynthesis of antibiotics
sue01200  Carbon metabolism
sue01212  Fatty acid metabolism
sue02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAOV_0610
   00630 Glyoxylate and dicarboxylate metabolism
    SAOV_0610
   00640 Propanoate metabolism
    SAOV_0610
   00650 Butanoate metabolism
    SAOV_0610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAOV_0610
   00072 Synthesis and degradation of ketone bodies
    SAOV_0610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAOV_0610
   00310 Lysine degradation
    SAOV_0610
   00380 Tryptophan metabolism
    SAOV_0610
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAOV_0610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAOV_0610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAOV_0610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sue04147]
    SAOV_0610
Enzymes [BR:sue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAOV_0610
Exosome [BR:sue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAOV_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADI97128
Position
640975..642114
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKFGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNMQLNIWGGALASGHPYGASGAQLVTRLFYMFDRETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatttggaggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgatccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatatgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacagagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system