KEGG   Staphylococcus aureus subsp. aureus ED133: SAOV_2729cHelp
Entry
SAOV_2729c        CDS       T01869                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sue  Staphylococcus aureus subsp. aureus ED133
Pathway
sue00340  Histidine metabolism
sue01100  Metabolic pathways
sue01110  Biosynthesis of secondary metabolites
sue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sue00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SAOV_2729c
Enzymes [BR:sue01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAOV_2729c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HALZ DUF4435 MbeB_N FadA DUF883 DUF4370
Motif
Other DBs
NCBI-ProteinID: ADI99166
Position
complement(2804794..2806044)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEKSVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSKEVLAACYITQVNQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDAIV
YDVFAQAEHDELARTYVISEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACYVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFDQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaagcagacgaatcaacagttagaaaaa
tcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtgcctggt
ggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagtagcgggt
gtagaaaatattgttgttgtgacaccacctcaacctaacggagtatccaaagaggtatta
gctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggcgctcaaagtatt
gctgcattgacttatggaacagaaacaatacctaaagttgataagattgtaggtccagga
aaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgatcaaatt
gcaggaccaacagaaatagcactgattattgatgacaccgcagatttagatgccatcgta
tatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcattagtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgctatgtcatgaatacaatcgcacctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggcgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggacctagtcatgtattacctacaaat
agaacagctagatttactaatgggttatcggtcaatgatttcttaacacggaacacggtc
attcatttatcaaaagatacatttgatcaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcatcaacagtccattttaatacgtcagtcttag

DBGET integrated database retrieval system