KEGG   Staphylococcus aureus subsp. aureus LGA251: SARLGA251_03160Help
Entry
SARLGA251_03160   CDS       T02085                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251
Pathway
suf00071  Fatty acid degradation
suf00072  Synthesis and degradation of ketone bodies
suf00280  Valine, leucine and isoleucine degradation
suf00310  Lysine degradation
suf00362  Benzoate degradation
suf00380  Tryptophan metabolism
suf00620  Pyruvate metabolism
suf00630  Glyoxylate and dicarboxylate metabolism
suf00640  Propanoate metabolism
suf00650  Butanoate metabolism
suf00900  Terpenoid backbone biosynthesis
suf01100  Metabolic pathways
suf01110  Biosynthesis of secondary metabolites
suf01120  Microbial metabolism in diverse environments
suf01130  Biosynthesis of antibiotics
suf01200  Carbon metabolism
suf01212  Fatty acid metabolism
suf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SARLGA251_03160 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SARLGA251_03160 (thl)
   00640 Propanoate metabolism
    SARLGA251_03160 (thl)
   00650 Butanoate metabolism
    SARLGA251_03160 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SARLGA251_03160 (thl)
   00072 Synthesis and degradation of ketone bodies
    SARLGA251_03160 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SARLGA251_03160 (thl)
   00310 Lysine degradation
    SARLGA251_03160 (thl)
   00380 Tryptophan metabolism
    SARLGA251_03160 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SARLGA251_03160 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SARLGA251_03160 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SARLGA251_03160 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suf04147]
    SARLGA251_03160 (thl)
Enzymes [BR:suf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SARLGA251_03160 (thl)
Exosome [BR:suf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SARLGA251_03160 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCC87085
Position
374499..375680
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGGFDSEIVPVSIPQRKGEPIVVSKDEGVRGDASVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggattgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacaacaaaatggtggatttgacagtgagattgtt
ccggtatcaattccacaacgcaaaggtgagccaatcgttgtttcaaaagatgaaggtgtt
cgaggagatgcctctgttgaaaaattaagtcgtttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system