KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_10270Help
Entry
SARLGA251_10270   CDS       T02085                                 

Definition
(GenBank) putative pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf00020  Citrate cycle (TCA cycle)
suf00620  Pyruvate metabolism
suf01100  Metabolic pathways
suf01120  Microbial metabolism in diverse environments
suf01200  Carbon metabolism
suf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SARLGA251_10270
   00620 Pyruvate metabolism
    SARLGA251_10270
Enzymes [BR:suf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SARLGA251_10270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 HlyD_D23 HlyD_3 RimK ATP-grasp_4 GARS_A RnfC_N GCV_H ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CCC87795
Structure
PDB: 

Position
1121699..1125151
Genome map
AA seq 1150 aa AA seqDB search
MKQIKKLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPA
ESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDKV
KARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIKATSGGGGKGMRIVREESEL
EDAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQK
VVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEHT
ITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGYAIQCRITTEDPLNDFMPDT
GTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLSTHAISFKQAEEKMVRSLREMR
IRGVKTNIPFLINVMKNKKFTSGDYTTKFIEETPELFDIQPSLDRGTKTLEYIGNVTING
FPNVEKRPKPDYELASIPTVSSSKIASFSGTKQLLDEVGPKGVAEWVKKQDDVLLTDTTF
RDAHQSLLATRVRTKDMINIASKTADVFKDGFSLEMWGGATFDVAYNFLKENPWERLERL
RKAIPNVLFQMLLRASNAVGYKNYPDNVIHKFVQESAKAGIDVFRIFDSLNWVDQMKVAN
EAVQEAGKISEGTICYTGDILNPERSNIYTLEYYVKLAKELEREGFHILAIKDMAGLLKP
KAAYELIGELKAAVDLPIHLHTHDTSGNGLLTYKQAIDAGVDIIDTAVASMSGLTSQPSA
NSLYYALNGFPRHLRTDIEGMESLSHYWSTVRTYYSDFESDIKSPNTEIYQHEMPGGQYS
NLSQQAKSLGLGERFDEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNDLDEQSVI
TDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPVDFEKVRE
LLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGETVEIEI
DKGKRLIIKLETISEPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKSNPSHI
GAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGD
LLIEIEKATD
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaataaaaaagttacttgttgctaaccgtggagaaattgcaattcgtatattc
agagcggcagcagaattagacatcagcacagttgcaatttattcgaatgaagacaaaagt
tcattacatagatataaagcagatgaatcctatttagttggaagtgatttaggtcctgct
gaaagttatttaaatattgagcgtatcattgatgtagcaaaacaagcgaatgtggatgcg
attcatcctggctatggatttttaagtgaaaatgaacaatttgcgcgtcgttgtgcagaa
gaagggattaaatttattggtcctcatttagaacatttagatatgtttggagataaagtt
aaagctcgtacaacggctatcaaggcagatttaccagttattcctggtacagacggtcca
attaaatcatatgaattagcaaaagaatttgcagaagaagctggtttcccgctaatgatt
aaagccacaagtggtggcggcggtaaaggtatgagaatcgttcgtgaagaaagtgaatta
gaagatgctttccatagagcaaaatcagaagcagaaaaatcatttggtaatagtgaagtt
tacatagaaagatatattgataatccaaagcatattgaagtacaagtcataggcgacgaa
catggaaatatcgtacacctatttgaacgtgattgttcagtacaacgtcgtcatcaaaaa
gttgtagaagttgcaccatcagttggattatcaccaacattacgtcaacgtatttgtgat
gctgcaattcaattgatggaaaatattaaatatgtcaatgcaggtactgttgagtttcta
gtatctggtgacgaattcttctttatagaagttaaccctcgtgtacaagtagagcataca
attacagagatggtaacaggaattgatattgttaagacacaaattttagttgcagcaggt
gccgatttatttggtgaagagattaatatgccgcaacaaaaagatattacaacattgggc
tatgccatccaatgtcgtattacaacagaagatccgttaaatgatttcatgccggatact
ggaacaatcattgcttatcgttcaagcggtggctttggtgtacgtcttgatgctggagat
ggtttccaaggtgctgagatatcaccttattatgattcattactcgtaaaattatctaca
cacgcgatatcatttaaacaagcagaagaaaaaatggtacgttcattacgagaaatgcgt
attcgtggtgttaaaactaatattccattcttaattaatgtaatgaaaaataaaaagttc
acaagtggtgattacacaactaaatttattgaagaaacaccagaacttttcgacattcag
ccgtctctagatagaggtactaaaacattagaatatataggtaatgtaacaattaatggt
ttcccaaatgttgagaaacgtccgaaaccagactatgaattagcatcaattccaactgta
tcttcaagtaaaatcgcttcatttagtggtacgaaacaattgcttgatgaagtaggtcca
aaaggtgtagctgaatgggttaaaaagcaggatgatgtcttactaacagatacaaccttt
agagatgcacaccaatcattattagctacacgagttagaactaaggatatgattaatatc
gcatccaaaacagcggacgtatttaaagacggtttctcactagaaatgtggggcggtgct
acatttgatgtggcatataatttcttgaaggaaaacccatgggaacgacttgaacgtcta
cgtaaagctattccaaatgtattattccaaatgttgttacgtgcttcaaacgcagttggt
tataaaaactatcctgataatgttattcataaattcgtacaagaaagtgctaaagcaggc
atagatgtctttagaattttcgattcattaaactgggtagatcaaatgaaagttgccaat
gaagcagtacaagaagcgggcaaaatctcagaaggtactatttgttatacaggtgacatt
ttaaatcctgagcgatcaaacatttatactttagagtattatgtcaaactagctaaagag
ttagaacgtgaaggtttccatattttagcgattaaagatatggcaggcttattaaaacct
aaagctgcttacgaattgattggtgagttaaaagcagctgtagatttaccaatccatctt
cacactcatgatacaagtggtaatggtttattaacgtacaaacaagcaatagatgctggt
gtcgatatcattgatactgctgttgcttcaatgagtggtttaacaagtcagccaagcgcc
aattcgttatattatgcattaaatggcttcccacgtcaccttagaactgatattgaaggt
atggagtcacttagtcattattggtcaactgtacgtacttattattcagactttgaaagt
gatatcaaatcaccgaatactgaaatttatcaacatgaaatgcctggtggacagtattcg
aatttaagtcaacaagctaaaagtttaggtttaggcgaaagatttgatgaagtcaaagat
atgtatcgcagagtgaatttcttatttggtgatatcgtaaaagtaacgccatcgtctaaa
gtagttggtgatatggcactttatatggtacaaaatgatcttgatgaacaatccgtgatt
acagatggctataaattagatttcccagaatcagtagtgtcgttcttcaaaggtgaaata
ggacaacctgtaaatggttttaataaagatttacaagcggttattttaaaaggccaagaa
gcactaacagctcgtccaggtgaatatctagagccggttgattttgaaaaagtccgtgag
ttgcttgaagaagagcaacaaggtcctgttacggagcaagatattattagttatgtatta
tatccaaaagtatatgaacaatatattcaaactagaaatcaatacggaaacttatcgtta
cttgatacgcctacattcttctttggaatgcgtaatggtgaaacagtagaaatcgaaatc
gataaaggtaaacgattaattattaaactagaaacgattagtgaaccagatgaaaatggt
aatagaacgatttactatgcgatgaatggtcaagcgagacgtatttacattaaagatgaa
aatgtgcatacaaatgcgaacgttaagccaaaagcagataagagtaatccaagtcatatc
ggtgcgcaaatgccaggttcagtaactgaagtcaaggttagtgtaggtgaaactgtgaaa
gctaatcagccgttgctaattactgaagctatgaaaatggaaacaacaattcaagcacca
tttgacggtgtgattaaacaagtaactgtaaataatggtgacacaatagcgacaggcgat
ttattaatcgaaattgaaaaagcaactgactaa

DBGET integrated database retrieval system