KEGG   Staphylococcus aureus subsp. aureus LGA251 (MRSA): SARLGA251_20310Help
Entry
SARLGA251_20310   CDS       T02085                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
suf  Staphylococcus aureus subsp. aureus LGA251 (MRSA)
Pathway
suf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:suf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SARLGA251_20310 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:suf03011]
    SARLGA251_20310 (rplV)
Ribosome [BR:suf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SARLGA251_20310 (rplV)
  Bacteria
    SARLGA251_20310 (rplV)
  Archaea
    SARLGA251_20310 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: CCC88796
Structure
PDB: 

Position
complement(2252356..2252709)
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaacaataagaatcgcacctcgtaaagtaagactagtt
cttgacttaatcagaggtaaaaatgctgctgaagctattgcaattttaaaattaacaaac
aaagcttcatcaccagtaattgaaaaagtattaatgtccgctttagctaatgctgaacat
aactatgacatgaacacagatgaattagtagttaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgcgcaaggtcgtgcaagtgcgattaacaaacgtaca
agccacattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system