KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0434Help
Entry
SAPIG0434         CDS       T02071                                 

Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00071  Fatty acid degradation
sug00072  Synthesis and degradation of ketone bodies
sug00280  Valine, leucine and isoleucine degradation
sug00310  Lysine degradation
sug00362  Benzoate degradation
sug00380  Tryptophan metabolism
sug00620  Pyruvate metabolism
sug00630  Glyoxylate and dicarboxylate metabolism
sug00640  Propanoate metabolism
sug00650  Butanoate metabolism
sug00900  Terpenoid backbone biosynthesis
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
sug01200  Carbon metabolism
sug01212  Fatty acid metabolism
sug02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAPIG0434
   00630 Glyoxylate and dicarboxylate metabolism
    SAPIG0434
   00640 Propanoate metabolism
    SAPIG0434
   00650 Butanoate metabolism
    SAPIG0434
  Lipid metabolism
   00071 Fatty acid degradation
    SAPIG0434
   00072 Synthesis and degradation of ketone bodies
    SAPIG0434
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAPIG0434
   00310 Lysine degradation
    SAPIG0434
   00380 Tryptophan metabolism
    SAPIG0434
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAPIG0434
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAPIG0434
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAPIG0434
Enzymes [BR:sug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAPIG0434
Exosome [BR:sug04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAPIG0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAQ48872
Position
449343..450524
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPAIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPSEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcagtcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatcctgctattatgggtattgccccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattaccttctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaaatataaataa

DBGET integrated database retrieval system