KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0453Help
Entry
SAPIG0453         CDS       T02071                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00010  Glycolysis / Gluconeogenesis
sug00260  Glycine, serine and threonine metabolism
sug00680  Methane metabolism
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
sug01200  Carbon metabolism
sug01230  Biosynthesis of amino acids
Module
sug_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sug_M00002  Glycolysis, core module involving three-carbon compounds
sug_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAPIG0453
  Energy metabolism
   00680 Methane metabolism
    SAPIG0453
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAPIG0453
Enzymes [BR:sug01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAPIG0453
Membrane trafficking [BR:sug04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAPIG0453
Exosome [BR:sug04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAPIG0453
  Exosomal proteins of melanoma cells
   SAPIG0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAQ48891
Position
467204..467785
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTETGTKSADDLCDYFKEKQIKHVYVSDL
LRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDPNFKDFRHS
FSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFNNVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggcgaatcaaaatcgaattatgataataaacatttt
cgatcttatttttgtggacaattagatgtgccgttaacggaaactggcacaaaaagtgca
gacgatttatgtgattattttaaagagaaacagattaaacatgtatatgtttcagactta
ttaagaacacagcaaacgtttgagcatatttttccatatgacattgcatcaacgactacg
cctctattaagagaacgttcacttggcgtatttgagggtgaatataaagatgaaatcagt
gcgaatccgaaatatgaaaaatatttcaatgatccaaactttaaagactttcgtcatagt
ttttcacaaaaagcgcctgaaggagaaagttatgaagatgtatatcaacgcgtagaacat
tttatgaatcatgttgtcaatgaagatacacaaaaagatgatattgttattgttgcacat
caagttgtcattcgttgtttaatggtttattttaataacgtttcacgggaagaagctgtg
gatttaaaagttgaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system