KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0556Help
Entry
SAPIG0556         CDS       T02071                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00450  Selenocompound metabolism
sug00970  Aminoacyl-tRNA biosynthesis
sug01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sug00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SAPIG0556 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAPIG0556 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sug01007]
    SAPIG0556 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sug03016]
    SAPIG0556 (metG)
Enzymes [BR:sug01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SAPIG0556 (metG)
Amino acid related enzymes [BR:sug01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SAPIG0556 (metG)
Transfer RNA biogenesis [BR:sug03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SAPIG0556 (metG)
 Prokaryotic type
   Other AARSs
    SAPIG0556 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1d ARL2_Bind_BART PilM
Motif
Other DBs
NCBI-ProteinID: CAQ48993
Structure
PDB: 

Position
577143..579116
Genome map
AA seq 657 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHVVEQVFERLLKQGDIYL
GEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHQVELVKEESYFFNISKYTDR
LLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNWGVHVPSNPKHVVYVWIDA
LVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIWPILLMALDLPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELPFGSDGVFTPEAFVERTNFDL
ANDLGNLVNRTISMINKYFDGELPAYQGPLHELDEEMEAMALETVKSYTESMESLQFSVA
LSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMAHLVENIRYAAVLLRPFLTHAPK
EIFEQLNINNPQFMEFSSLEQYGVLTEPIMVTGQPKPIFPRLDSEAEIAYIKESMQPPAT
EEEKEEIPSKPQIDIKDFDKVEIKAATIIDAEHVKKSDKLLKIQVDLDSEQRQIVSGIAK
FYTPDDIIGKKVAIVTNLKPAKLMGQKSEGMILSAEKDGVLTLVSLPSAIPNGAVIK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacattttatataacaaccccaatatactatcctagtgggaatttacat
ataggacatgcatattctacagtggctggagatgttattgcaagatataagagaatgcaa
ggatatgatgttcgttatttgactggaacggatgaacacggtcaaaaaattcaagaaaaa
gctcaaaaagctggtaagacagaaattgaatatttggatgagatgattgctggaattaaa
caattgtgggctaagcttgaaatttcaaatgatgattttatcagaacaactgaagaacgt
cataaacatgtcgttgagcaagtatttgaacgtttattaaagcaaggtgatatctattta
ggtgaatatgaaggttggtattctgttccggatgaaacatactatacagagtcacaatta
gtagacccacaatacgaaaacggtaaaattattggtggtaaaagtccagattctggacac
caagttgaactagtaaaagaagaaagttatttctttaatattagtaaatatacagaccgt
ttattagagttctatgaccaaaatccagattttatacaaccaccatcaagaaaaaatgaa
atgattaacaacttcattaaaccaggacttgctgatttggctgtttctcgtacatcattt
aactggggtgtccatgttccgtctaatccaaaacatgttgtttatgtttggattgatgcg
ttagttaactatatttcagcattaggctatttatcagatgatgagtcactatttaacaaa
tactggccagcagatattcatttaatggctaaggaaattgtgcgattccactcaattatt
tggcctattttattgatggcattagacttaccgttacctaaaaaagtctttgcacatggt
tggattttgatgaaagatggaaaaatgagtaaatctaaaggtaatgtcgtagaccctaat
attttaattgatcgctatggtttagatgccacacgttattatctaatgcgtgaattacca
tttggttcagatggcgtatttacacctgaagcatttgttgagcgtacaaatttcgatcta
gcaaatgacttaggtaacttagtaaaccgtacgatttctatgattaataagtactttgat
ggcgaattaccagcgtatcaaggtccacttcatgaattagatgaagaaatggaagctatg
gctttagaaacagtgaaaagctatactgaaagcatggaaagtttgcaattttctgtggca
ttatctacggtatggaagtttattagtagaacgaataagtatattgacgaaacaacgcct
tgggtattagctaaggacgatagccaaaaagatatgttaggcaatgttatggctcactta
gttgaaaatattcgttatgcagctgtattattacgtccattcttaactcatgcgccgaaa
gagatttttgaacaattgaacattaacaatcctcaatttatggaatttagtagtttagag
caatatggtgtgcttactgagccaattatggttactgggcaacctaaacctattttccca
agattggatagcgaagcggaaattgcatatatcaaagaatcaatgcaaccgcctgctact
gaagaggaaaaagaagagattcctagcaaacctcaaattgatattaaagactttgataaa
gttgaaattaaggcagcaacgattattgatgctgaacatgttaagaagtcagataagctt
ttaaaaattcaagtagacttagattctgaacaaagacaaatcgtatcaggaattgccaaa
ttctatacaccagatgatattattggtaaaaaagtagcaattgttactaacttgaaacca
gctaaattaatgggacaaaaatctgaaggtatgatattatctgctgaaaaagatggtgta
ttaaccttagtaagtttaccaagtgcaattccaaatggtgcagtgattaaataa

DBGET integrated database retrieval system