KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG0650Help
Entry
SAPIG0650         CDS       T02071                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00071  Fatty acid degradation
sug00072  Synthesis and degradation of ketone bodies
sug00280  Valine, leucine and isoleucine degradation
sug00310  Lysine degradation
sug00362  Benzoate degradation
sug00380  Tryptophan metabolism
sug00620  Pyruvate metabolism
sug00630  Glyoxylate and dicarboxylate metabolism
sug00640  Propanoate metabolism
sug00650  Butanoate metabolism
sug00900  Terpenoid backbone biosynthesis
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
sug01200  Carbon metabolism
sug01212  Fatty acid metabolism
sug02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAPIG0650
   00630 Glyoxylate and dicarboxylate metabolism
    SAPIG0650
   00640 Propanoate metabolism
    SAPIG0650
   00650 Butanoate metabolism
    SAPIG0650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAPIG0650
   00072 Synthesis and degradation of ketone bodies
    SAPIG0650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAPIG0650
   00310 Lysine degradation
    SAPIG0650
   00380 Tryptophan metabolism
    SAPIG0650
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAPIG0650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAPIG0650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAPIG0650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sug04147]
    SAPIG0650
Enzymes [BR:sug01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAPIG0650
Exosome [BR:sug04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAPIG0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAQ49078
Position
688241..689380
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVATKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKSLLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGGIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDKAYELGFNHGLLFKDGVTVGVDSNLPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVIACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcaactaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaatcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggggctggaaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggaggaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggcgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagataaggcatacgaattaggtttcaat
catggtttattatttaaagatggtgttacggtaggtgttgattctaatttacctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtgattgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagactatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system