KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG1371Help
Entry
SAPIG1371         CDS       T02071                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01130  Biosynthesis of antibiotics
sug01230  Biosynthesis of amino acids
Module
sug_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAPIG1371 (trpC)
Enzymes [BR:sug01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAPIG1371 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAQ49795
Position
1444067..1444849
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQSLLQNGYYQDKLSTLKSVNIQNKKSFINTIEQEPKLVIIAEIKSKSPT
VNDLPERDLSQQISDYEQYGANAVSILTDEKYFGGSFERLQELTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLRELYEYATSQSLEVLVEVHDREELDRAYKINPKL
IGVNNRDLKRFVTKVEHTNIILENKQPNHYYISESGIHDTSDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagtcacttttacaaaatggctattac
caagacaaacttagcactttaaaaagtgtgaacattcagaataaaaaatcttttataaac
acaattgaacaggaaccaaagttagtaattattgcagaaattaaatcaaagagtcccaca
gttaatgacttacctgaacgagatttatctcaacaaatttctgattatgaacagtacggt
gcaaatgcagtttcaattttaacagatgaaaagtactttggagggagctttgaacgttta
caagaattaacaacaaaaacgacacttccagtattgtgtaaagactttattatagatccg
cttcaaattgacgttgctaaacaagctggtgcatctatgattttacttatagttaatatc
ttatctgataaacaattgagagagttatacgaatacgctacttctcaaagtttagaagta
ttggtggaagttcatgatcgtgaagaattagaccgtgcctataagattaatcctaaatta
atcggtgtaaataatcgtgatttaaaacgttttgttacaaaagtggaacatacaaatatt
attttagaaaataaacagccgaatcattattatatttcagaaagcggtattcatgatacc
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgcgacaatctatctgaatttttaccacaactaaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system