KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2062Help
Entry
SAPIG2062         CDS       T02071                                 

Definition
(GenBank) probable succinyl-diaminopimelate desuccinylase (sdap)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00300  Lysine biosynthesis
sug01100  Metabolic pathways
sug01120  Microbial metabolism in diverse environments
sug01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SAPIG2062
Enzymes [BR:sug01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SAPIG2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAQ50450
Position
2136408..2137631
Genome map
AA seq 407 aa AA seqDB search
MTTFSEKEKIQLLADIVELQTENNNEIDVCNYLKDLFDKYDIKSEILKVNEHRANFVAEI
GSGSPILALSGHMDVVDAGNQDNWTYPPFQLTEKDDKLYGRGTTDMKGGLMALVIALIEL
KEQNQLPQGTIRLLATAGEEKEQEGAKLLADKGYLDDVDGLMIAEPTGSGIYYAHKGSMS
CKVTATGKAVHSSVPFIGDNAIDTLLEFYNQFKEKYAELKKNDTKHELDVAPMFKSLIGK
DISEEDANYASGLTAVCSIINGGKQFNSVPDEASLEFNVRPVPEYDNDFIESFFQNIINN
VDSNKLSLDIPSNHRPVTSDKNSKLITTIKDVASSYVDKDDIFVSALVGATDASSFLGDN
KDNVDLAIFGPGNPLMAHQIDEYIEKDMYLKYIDIFKEASIQYLKEK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttttagtgaaaaagaaaaaattcaattactagcagatattgttgaactacaa
actgaaaataataatgaaatagacgtttgtaattatttaaaagatttattcgacaagtac
gatattaaatctgaaattttgaaagttaatgaacaccgcgccaatttcgttgcagaaatc
ggtagtggctctcccatacttgcattgagcggtcatatggatgttgttgatgcaggaaat
caagataattggacttatcccccttttcaactcacagaaaaagatgacaaattatatggt
cgaggcacaacagatatgaaaggcggtctgatggctttggtcatcgcactcattgaatta
aaagaacaaaaccaattacctcaaggaaccattagattactcgctactgctggtgaagag
aaagaacaagaaggcgccaaattattagcagataaaggctatttagatgatgttgatggt
ctaatgattgctgaaccaactggatctggaatttattatgcacataaagggtctatgtca
tgtaaagtaactgcaactggtaaagctgtccatagctcagttccatttattggtgacaat
gcaattgatacactgcttgaattttataatcaatttaaagaaaaatatgcagagcttaaa
aaaaatgatactaaacatgagttagatgttgctcccatgttcaaatcattgataggaaaa
gatatttctgaagaggatgcaaattatgcatctggtcttacagctgtatgttcgattata
aatggcggtaaacaatttaactctgtcccagatgaagcttcacttgaatttaacgtaaga
ccagttcctgagtatgataacgactttatagaatcgtttttccaaaatatcattaataat
gtggatagcaataagctttcactcgatattccaagtaaccatcgacctgtaacaagcgat
aaaaatagcaaattaattactacgattaaagatgtagcttctagttatgtagacaaagac
gatatatttgtttcggcgcttgtaggtgcaacggatgcttccagcttcttaggagataat
aaggacaatgttgatttagccatttttggaccaggtaatccattaatggcacatcaaatc
gatgaatatattgaaaaagatatgtatctgaaatatattgatattttcaaagaggcttcc
attcaatatttaaaggagaaataa

DBGET integrated database retrieval system