KEGG   Staphylococcus aureus subsp. aureus ST398 (MRSA): SAPIG2568Help
Entry
SAPIG2568         CDS       T02071                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sug  Staphylococcus aureus subsp. aureus ST398 (MRSA)
Pathway
sug00010  Glycolysis / Gluconeogenesis
sug00030  Pentose phosphate pathway
sug00051  Fructose and mannose metabolism
sug00680  Methane metabolism
sug01100  Metabolic pathways
sug01110  Biosynthesis of secondary metabolites
sug01120  Microbial metabolism in diverse environments
sug01130  Biosynthesis of antibiotics
sug01200  Carbon metabolism
Module
sug_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sug00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAPIG2568 (fbp)
   00030 Pentose phosphate pathway
    SAPIG2568 (fbp)
   00051 Fructose and mannose metabolism
    SAPIG2568 (fbp)
  Energy metabolism
   00680 Methane metabolism
    SAPIG2568 (fbp)
Enzymes [BR:sug01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAPIG2568 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 GP24_25
Motif
Other DBs
NCBI-ProteinID: CAQ50948
Position
2654516..2656480
Genome map
AA seq 654 aa AA seqDB search
MTQITERELKKKYLDLLSQHFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKDKLSTKELNDLTALVYYPEDKLQLIKCDFQNYGQLNVWYITT
IEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDTNEITVYGKT
YPLKDTCFQTVNRDNPAELLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPCNGN
LLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRIVDKELQRKKIRNTNKGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaagagaattaaaaaagaaatatttggatttattatctcaacat
ttcgatactccagaaaagcttgcgactgaaattattaatttagaatctattttagaatta
cctaaaggtacggagcatttcgttagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaattaatgatattttcaaagacaag
ttatcaacgaaagaacttaacgatttgactgcccttgtttactatccagaagacaaattg
caacttattaaatgtgattttcaaaattatggacaattaaatgtttggtatattacgacg
attgaacacctcattcagctaattaaatattgttcttcaaaatatacgcgttcaaaactt
cgacgtgccttgccggagcaatacgttttcatcgtagaagagttattatataagaacaac
gaattcaaaaataaaaaatcttactacgaaacacttgtaaatcaagtgattgagcttaag
caggcggatgatttaattatagggcttgcgtattctgtacaacgcttagtcgtcgatcat
ttacacgttgttggtgatatttatgatcgtggcccgcaaccagataaaatcatggacacg
ctgattaattatcattctctggatattcaatggggtaatcatgatgtgctatgggttggt
gcttatgcagggtctaaagtatgtttagctaatttactacgtatttgtgcacgttatgac
aatctagatatcgttgaagatgcttacggtattaatttaagacctttgctaacattagcc
gaaaaatactatgatgcagataaccctgcttttaaacctaaaaaaagacctgacaaacat
gaacgtttaacacaacgcgaagaaagtcagattactaaaattcatcaagctattgcgatg
attcaattcaaactggaaataccggttattaagcgccgtccaaactttgaaatggacgaa
cgacttgtacttgaaaaagttaattatgatactaatgaaataacagtatacggaaaaaca
tatccattaaaagatacatgcttccaaactgttaaccgtgataacccagcagaattacta
cctgaagaagaagaagtcatgaataaactattattgtcattccaacaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctcactttacttaccttgtaatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcattcgaaatt
gatggtcagacatacagtggccaagagttattagatgtgtttgaatatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatccactgatttagtttggtatttatgg
actgggaaatactcttcactatttggtaaacgtgcgatgactacgtttgaacgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggtgcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaattaatggggaagatcctatcaaggctgatgga
aagatgcttgtcattgatggtggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacattgttgtataattcattcggaatgcaactcgttgcacatcaacaatttaac
gcaaaagaaaaaattctttccgaaggtatcgacgaactgtcaattaaacgtattgttgat
aaagaattacaacgtaaaaaaatccgcaatacaaataaaggtaaagagcttcaggctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system