KEGG   Staphylococcus argenteus: SAMSHR1132_03480Help
Entry
SAMSHR1132_03480  CDS       T01767                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00260  Glycine, serine and threonine metabolism
suh00680  Methane metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
suh01230  Biosynthesis of amino acids
Module
suh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suh_M00002  Glycolysis, core module involving three-carbon compounds
suh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_03480
  Energy metabolism
   00680 Methane metabolism
    SAMSHR1132_03480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAMSHR1132_03480
Enzymes [BR:suh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAMSHR1132_03480
Membrane trafficking [BR:suh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAMSHR1132_03480
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAMSHR1132_03480
  Exosomal proteins of melanoma cells
   SAMSHR1132_03480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCE58201
UniProt: A0A077V9V5
Position
400322..400903
Genome map
AA seq 193 aa AA seqDB search
MTIYLVRHGESKSNYDNKHSRSYFCGQLDVPLTNTGKESADGLCQYFKEKNIAHVYVSDL
LRTQQTFEHIFPYDIPSTTTPLLRERSLGVFEGEYKDDVSVNSKYEKYFNDPKFKDFRHS
FSQKAPEGESYEDVYQRVSHFMNHVVSEDTEEDDIVIVAHQVVIRCLMVYFNKVSREEAV
DLKVENCKPYIIE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttatttagttagacatggagaatcgaagtcgaattatgataataaacattcg
cgatcgtatttttgtggtcaattagatgtaccgttaacgaatactggtaaagaaagtgca
gacggtttatgccagtattttaaagaaaaaaatatagcacatgtatatgtgtcggactta
ttaaggacacaacaaacatttgaacatatttttccatatgacattccatctacgacaaca
cctttattaagagaacgttcattaggtgtattcgagggtgaatataaagatgatgtcagt
gttaattcgaaatatgaaaaatattttaatgatcctaagtttaaagattttcgtcatagt
ttttctcaaaaagcgcctgaaggagagagttatgaagacgtatatcaacgtgtgtcccat
tttatgaatcatgttgttagtgaagatactgaagaagatgatatcgtcattgttgcacat
caagttgtcattcgttgtttgatggtttattttaacaaagtttcaagagaagaagctgtc
gatttaaaagtagaaaattgcaaaccatatatcattgaatag

DBGET integrated database retrieval system