KEGG   Staphylococcus argenteus: SAMSHR1132_05190Help
Entry
SAMSHR1132_05190  CDS       T01767                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suh  Staphylococcus argenteus
Pathway
suh00071  Fatty acid degradation
suh00072  Synthesis and degradation of ketone bodies
suh00280  Valine, leucine and isoleucine degradation
suh00310  Lysine degradation
suh00362  Benzoate degradation
suh00380  Tryptophan metabolism
suh00620  Pyruvate metabolism
suh00630  Glyoxylate and dicarboxylate metabolism
suh00640  Propanoate metabolism
suh00650  Butanoate metabolism
suh00900  Terpenoid backbone biosynthesis
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
suh01212  Fatty acid metabolism
suh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMSHR1132_05190
   00630 Glyoxylate and dicarboxylate metabolism
    SAMSHR1132_05190
   00640 Propanoate metabolism
    SAMSHR1132_05190
   00650 Butanoate metabolism
    SAMSHR1132_05190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMSHR1132_05190
   00072 Synthesis and degradation of ketone bodies
    SAMSHR1132_05190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMSHR1132_05190
   00310 Lysine degradation
    SAMSHR1132_05190
   00380 Tryptophan metabolism
    SAMSHR1132_05190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMSHR1132_05190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMSHR1132_05190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMSHR1132_05190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suh04147]
    SAMSHR1132_05190
Enzymes [BR:suh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMSHR1132_05190
Exosome [BR:suh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMSHR1132_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCE58376
Position
608405..609544
Genome map
AA seq 379 aa AA seqDB search
MKQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQYYKKQYPEVISKIDDVILGNVVGNG
GNIARKALLEAGLQESIPGVTIDRQCGSGLESIQYACRMIQAGAGKIYFAGGVESTSRAP
WKIKRPQSVYETSLPEFYERASFAPEMSDPSMIEGAENVAKVYGVTRELQDDFAFRSHQL
TEENVQNHNISQEILPLTVKGKIFEKDESIKSHILRENYRRFKPIIKGGTVTAANSCMKN
DGAVLLLIMEKDIANALGFKQGLLFKDNVTIGVDSTLPGIGPVPAISELLKRNQLNIEDI
DAIEINEAFSAQVVACQQALNIKNSQLNIWGGALATGHPYGASGAQLVTRLFYMYEKDTL
IASMGIGGGLGNAALFSRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcagttatagttgcagccaaacggacagcatttggtaagtatggtgggact
ttaaaacatctagaacctgagcaattacttaaaccattattccaatattataaaaagcaa
tatccagaggtaatatctaaaattgatgatgttattttaggtaatgttgtaggaaatggt
ggtaatattgctagaaaagcgttacttgaagcgggtctgcaagaatcgatacctggtgtg
acaattgaccgtcaatgtggttccggtcttgaaagtattcaatatgcatgtcgaatgatt
caagctggtgctggtaagatatattttgcaggtggtgtagaaagtacgagtagagcacca
tggaaaattaaacgtccacaatctgtatacgagacgtcgctaccagaattttatgaacga
gcatcttttgcaccagaaatgagcgacccttcgatgattgaaggcgcagaaaatgtagca
aaagtatatggtgtaaccagagaattacaagatgactttgcatttcgaagtcatcaactt
actgaggaaaatgtacaaaatcataatatttctcaggaaatactaccactgacagtaaaa
ggtaaaatattcgaaaaagacgaaagcataaaatcacatatacttagagaaaattatcgt
cgttttaagccaattataaaaggtggaacagttacagctgcgaatagttgtatgaaaaac
gatggggcagttttattacttattatggaaaaagatattgcgaatgctttgggatttaag
caaggattattatttaaggataatgtgacgataggtgttgattctacgttacctggtatc
ggtccagttccagcaatttccgaattattaaaaagaaatcaattaaacattgaagatatt
gacgctattgaaataaatgaagcatttagtgcacaagtcgttgcttgtcagcaagcgtta
aacattaaaaatagtcaattgaatatttggggtggtgcattagcgacaggacatccatat
ggcgcaagtggtgcgcaattggtgacgcgtttgttttatatgtatgaaaaagatacgtta
attgcttcaatggggattggaggaggtttaggtaatgcagcattatttagcagattctaa

DBGET integrated database retrieval system