KEGG   Staphylococcus argenteus: SAMSHR1132_12130Help
Entry
SAMSHR1132_12130  CDS       T01767                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suh  Staphylococcus argenteus
Pathway
suh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01130  Biosynthesis of antibiotics
suh01230  Biosynthesis of amino acids
Module
suh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMSHR1132_12130
Enzymes [BR:suh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAMSHR1132_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AP_endonuc_2 BBE
Motif
Other DBs
NCBI-ProteinID: CCE59065
Position
1355677..1356459
Genome map
AA seq 260 aa AA seqDB search
MTILEEIVEYKQSLLQNGYYLEKLNSLKSVNIQNKKSFINSIEQKSTLAIIAEIKSKSPT
VNDLPERDLLQQISDYEQYGANAVSILTDEKYFGGSFERLQELTTKTTLPVLCKDFIIDP
LQIDVAKQAGASIILLIVNILSDKQLKELYEYATSQNLEVLVEVHNREELYRAYKINPKL
IGVNNRDLKRFVTNVEHTNIILENKQPNHYYISESGIHDTSDVEKILNSGIDGLLIGEAL
MRCDNLAKFLPQLKMQKVQS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttagaagaaattgttgaatataaacagtcacttttacaaaatggctattat
ctagagaaacttaatagcttaaaaagtgtgaacattcagaataaaaagtcttttataaat
tcaattgaacaaaaatcaacattagcaattattgcagaaattaaatctaagagtcctaca
gttaatgatttacctgaacgagatttattgcaacaaatctctgattatgaacagtatggt
gcaaatgcagtttcgattttaacagatgaaaagtattttggtggtagttttgaacgttta
caagaattaacaacaaaaacgacacttccagtactgtgtaaagactttattatagatccg
cttcaaatcgatgttgctaaacaagctggtgcatctattattttattaattgttaacatc
ttgtcagataaacaattgaaagagttatacgaatacgctacttctcaaaatttggaagta
ttggttgaagttcataatcgtgaggaattatatcgtgcctataagattaatcctaaattg
attggtgtaaataacagagacttaaaaaggtttgtcacaaatgtggaacatacaaatatt
attttagaaaataaacaaccgaatcattattatatttctgaaagtggcatacacgacaca
tctgatgttgaaaaaattttaaacagtggcatcgatggcttactaataggtgaggcactc
atgcgttgcgacaatctggccaaatttttaccacaactaaaaatgcaaaaggtgcaatca
tga

DBGET integrated database retrieval system