KEGG   Staphylococcus argenteus: SAMSHR1132_13880Help
Entry
SAMSHR1132_13880  CDS       T01767                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
suh  Staphylococcus argenteus
Pathway
suh00010  Glycolysis / Gluconeogenesis
suh00052  Galactose metabolism
suh00500  Starch and sucrose metabolism
suh00520  Amino sugar and nucleotide sugar metabolism
suh00521  Streptomycin biosynthesis
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh01120  Microbial metabolism in diverse environments
suh01130  Biosynthesis of antibiotics
suh01200  Carbon metabolism
Module
suh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:suh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMSHR1132_13880
   00052 Galactose metabolism
    SAMSHR1132_13880
   00500 Starch and sucrose metabolism
    SAMSHR1132_13880
   00520 Amino sugar and nucleotide sugar metabolism
    SAMSHR1132_13880
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAMSHR1132_13880
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SAMSHR1132_13880
Enzymes [BR:suh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAMSHR1132_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: CCE59236
UniProt: A0A077V3K1
Position
complement(1544861..1545847)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTTDSTGYTLLKGIYDSFVEQVDANN
YDFSNVLGVGIGVPGPVDFENGTVNGAVNLYWPGKVNVREIFEQFVECPVFVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLVNFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFKPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcggaacaacttgtaaattagggattttt
acacctgaattagaacaattacataaatggtcaatccacacagatacaactgatagtaca
gggtatacactattaaaaggtatctatgattcatttgttgaacaagttgatgccaataat
tatgacttttctaacgtgctaggcgtaggaataggtgtgccaggtccagttgactttgaa
aatggcacagttaacggcgcagttaatttatactggccaggaaaagtaaatgtgcgtgaa
atatttgaacagtttgttgagtgtccagtttttgtagataatgacgcaaacattgctgct
ttaggagaaaaacataaaggtgctggtgaaggtgctgatgatgttgtagcaattacactt
ggaacaggtctaggtggaggtatcatttcaaatggtgaaatcgttcatggacataatggt
tctggtgcagaaatcggacattttagagctgattttgatcaacgattcaaatgtaattgt
ggccgttctggctgcattgaaacggttgcatctgctacaggtgttgtcaatttagttaat
ttctactatccaaaattaacttttagatcttcaattttagaattaattaaagagaataaa
gttacggctaaagctgttttcgatgctgctaaagcgggagatcagttctgtatttttata
actgaaaaagtagcaaactatattggatatttatgtagtattattagtgtaactagtaac
cctaaatacattgtacttggcggagggatgtcgacggcaggacctattttaattgaaaat
attaaaacggaatatcataatttaacatttaaaccggcacaatttgaaactgaaatcgta
caagcaaagttaggtaacgatgctggcattactggtgcagcaggtttaattaaaacatat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system