KEGG   Staphylococcus argenteus: SAMSHR1132_17840Help
Entry
SAMSHR1132_17840  CDS       T01767                                 

Definition
(GenBank) phospholipase C precursor (pseudogene)
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
suh  Staphylococcus argenteus
Pathway
suh00562  Inositol phosphate metabolism
suh00564  Glycerophospholipid metabolism
suh01100  Metabolic pathways
suh01110  Biosynthesis of secondary metabolites
suh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SAMSHR1132_17840
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAMSHR1132_17840
   00565 Ether lipid metabolism
    SAMSHR1132_17840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAMSHR1132_17840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:suh02042]
    SAMSHR1132_17840
Enzymes [BR:suh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SAMSHR1132_17840
Bacterial toxins [BR:suh02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SAMSHR1132_17840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Lipocalin
Motif
Other DBs
NCBI-ProteinID: CCE59621
UniProt: A0A348BCK7
Position
join(1969320..1969502,2012001..2012810)
Genome map
AA seq 330 aa AA seqDB search
MIKKIKSNSLKKVATIALANLILVGALSESNAKAETKKDDTDLKLVSHNVYMLSTLLYPN
WGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLNNVKKEYPYQTPVLGRSHSGWDK
TEGNYSNTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVI
GTHTQSEDTRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTEEFKDM
LKNLNVNDVLYAGHNSTWDPKSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLINEVVTE
KPKPWDVYAFPYYYVYNDFSDHYPIKAYSK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaataaaatctaattctttaaaaaaagttgcaactattgcattagccaat
ttaatattagttggagcgcttagcgagagtaacgctaaagccgaaactaagaaagatgat
actgatttgaagttagtgagtcataatgtttacatgttatcgaccctactgtatccgaac
tggggccaatataaacgagctgatttaattggtcagtcttcatatattaaaaataatgat
gttgttattttcaatgaagcatttgataatggtgcatctgataagttattaaataatgtt
aaaaaagaatatccatatcaaacacctgtgcttggtcgttctcattctggttgggataaa
actgaaggtaattattctaatacagttgctgaagatggtggcgtagcaattgtaagtaaa
tatccgattaaagaaaaaattcaacatgttttcaaaagcggttgtggatttgataatgat
agtaacaaaggatttgtttatacaaaaatagaaaaaaatggtaaaaacgtccatgttatc
ggaacacatacacaatcagaagatactcgttgtggtgctggtcatgatagaaaaattaga
gctgaacaaatgaaagaaattagcgactttgttaaaaagaaaaacatccctaaagacgaa
actgtatatatcggtggcgacttgaatgtcaataaaggtactgaagagttcaaagatatg
cttaaaaacttaaacgttaatgatgttttatatgcaggtcacaacagtacatgggatcca
aaatcgaattctattgcaaaatataattatcctaatggcaaaccagaacatttagactat
atattcacagacaaagatcataaacaacctaagcaattaatcaatgaggttgttactgaa
aaaccaaaaccatgggatgtatatgcgttcccttactattatgtatacaatgatttttca
gatcattacccaatcaaagcctatagtaaatag

DBGET integrated database retrieval system