KEGG   Staphylococcus argenteus: SAMSHR1132_19910Help
Entry
SAMSHR1132_19910  CDS       T01767                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
suh  Staphylococcus argenteus
Pathway
suh00051  Fructose and mannose metabolism
suh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAMSHR1132_19910
Enzymes [BR:suh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SAMSHR1132_19910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N NAD_Gly3P_dh_N Sacchrp_dh_NADP UDPG_MGDP_dh_N Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: CCE59820
UniProt: A0A380CKQ0
Position
2164962..2166068
Genome map
AA seq 368 aa AA seqDB search
MKAVHFGAGNIGRGFIGYILADNNVKVTFADVNEEIINALATEHQYDVILADESKTTTRV
NNVDAINSMQPSEALKQAILEADIITTAVGVNILPIIAKSFAPFLKEKTNHVNIVACENA
IMATDTLKQAVLDITGPLGDHIHFANSAVDRIVPLQKNENILDVMVEPFYEWVIEKNAWY
GPELEHIKYVDDLTPYIERKLLTVNTGHAYLAYAGQFAGKATVLDAVEDSSIEAGLRRVL
SETSQYITNEFDFTEEEQAGYVEKIIDRFNNPYLSDEVTRVGRGTLRKIGPKDRIIKPLT
YLYNKDLERTGLLNTAALLLKYDDSADQETVEKNNYIDAHGLKAFLNEYAKVDDGLADEI
IEAYNSLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcactttggtgctggtaatataggtcgtggatttattggatatattcta
gcagataacaatgtaaaagtaacatttgcagatgttaatgaagaaatcattaatgcttta
gctactgaacatcaatatgatgttattttagctgatgagtctaaaacaacaacacgagtg
aataatgttgatgcaattaattcaatgcaaccttccgaagcattgaaacaagcaatttta
gaagctgatattattacaacagctgtaggtgttaatattttaccgattattgctaaatct
tttgcaccgtttttaaaagaaaaaacaaatcatgtaaatattgtagcttgtgaaaatgcc
attatggcaactgatactttgaaacaagcggttcttgatatcactgggcctcttggcgat
catattcatttcgctaattctgctgttgatagaattgtaccattacaaaaaaatgaaaat
atactagatgttatggtagaaccattttacgaatgggttattgaaaaaaatgcatggtat
ggtccagaattagaacatattaaatatgttgatgatttaacaccatatattgaacgaaaa
ttactgactgttaatacgggtcatgcttatctagcttatgctggacagtttgctggtaaa
gctacagttttagatgctgttgaagatagttcaattgaagctggtttacgtcgtgtttta
tcagaaacaagtcaatatattaccaatgaatttgattttactgaggaagaacaagcaggt
tatgttgaaaaaattattgatcgtttcaataatccatatttatctgacgaagtaacacgc
gtaggacgaggtacattacgtaaaattggacctaaagatcgaattattaaaccattaact
tatctttacaataaagatttagaacgaacaggtttgctaaatacagcggcattattatta
aaatatgatgattcagcagaccaagaaaccgttgagaaaaataattatattgacgcgcac
ggtttaaaagctttcttaaatgaatatgcaaaagttgatgatggtctcgctgatgagatt
attgaagcttacaattcactttcataa

DBGET integrated database retrieval system