KEGG   Streptococcus suis JS14 (serotype 14): SSUJS14_0804Help
Entry
SSUJS14_0804      CDS       T02024                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sui  Streptococcus suis JS14 (serotype 14)
Pathway
sui00561  Glycerolipid metabolism
sui00640  Propanoate metabolism
sui01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SSUJS14_0804 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SSUJS14_0804 (gldA)
Enzymes [BR:sui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SSUJS14_0804 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ADV69889
Position
817117..818211
Genome map
AA seq 364 aa AA seqDB search
MKVFASPSRYIQGKHVLFQGAEAIGKLGTKPLILCDDLVYGIIGEKFLSYLVEEGMQVHR
VAFNGEASDKEIQRVVEIGKEQASDVVIGLGGGKTIDSAKAIADLLGVPVVIAPTIASTD
APTSALSVIYSEEGAFERYIFYKKNPDLVLVDTAIICQAPPRLLASGIADGLATWVEARA
ILQSNGTTMAGGGQTLAGIAIAQTCEQTLFEYGLQAMASCEAKVVTAALENIVEANTLLS
GLGFESAGLAAAHAIHNGFTALEGDIHHLTHGEKVAYGTLTQLFLENRPKEELEKYIRFY
QALNLPTTLEELHLADASYEELLKVGQQATIEGETIHGMPFAISAEDVAEALMAVDYYVR
SLDK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttgcaagtccatctcgctatattcaaggtaaacatgtccttttccaaggt
gcagaagctatcggaaaattgggaacaaagcctttgattctttgtgatgatttagtatat
gggattatcggtgagaagtttttgtcctatctcgttgaagaagggatgcaagtccatcgt
gttgcctttaatggagaagcatctgacaaggaaatccagcgcgtcgtagaaatcggaaaa
gaacaggctagtgacgtcgtaatcggtctaggtggtggcaagacgattgactcagccaag
gcgattgctgatttactaggagtgccagttgtcattgctccaactattgcttcaacagat
gctccgacctctgctttatctgtcatttattctgaagaaggggcgtttgaacgctatatt
ttctataagaaaaatccagatcttgtcttggtagatacagcgattatttgtcaagcaccg
ccacgtcttttggcttctggtattgcggatggcttggcgacgtgggtggaagcgcgtgct
attttacaaagcaatggaacaacaatggcaggaggaggtcagacacttgctggtatcgct
attgcacaaacctgtgaacaaacactctttgaatacggacttcaagccatggccagctgt
gaagccaaggttgtgacagctgctttagagaatattgttgaagccaataccttgctaagt
ggtttaggctttgaaagtgcaggtttggctgcggcgcatgcgatacacaatggattcacc
gccttggagggagacattcaccatttgacacatggtgaaaaagtggcttatgggaccttg
acccagctctttttggaaaaccgtcctaaagaagaattggaaaaatacatccgtttctat
caagccttgaatcttccaacaactttggaggagttacatttggctgatgctagttatgaa
gaactattgaaagtcggccaacaagcgacgattgaaggagaaacaattcacggtatgcca
tttgctatttcagcagaagacgttgcagaagctctgatggcagttgactactatgttcgc
tcattagataaataa

DBGET integrated database retrieval system