KEGG   Streptococcus suis JS14 (serotype 14): SSUJS14_1611Help
Entry
SSUJS14_1611      CDS       T02024                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sui  Streptococcus suis JS14 (serotype 14)
Pathway
sui00071  Fatty acid degradation
sui00072  Synthesis and degradation of ketone bodies
sui00280  Valine, leucine and isoleucine degradation
sui00362  Benzoate degradation
sui00380  Tryptophan metabolism
sui00620  Pyruvate metabolism
sui00630  Glyoxylate and dicarboxylate metabolism
sui00640  Propanoate metabolism
sui00650  Butanoate metabolism
sui00900  Terpenoid backbone biosynthesis
sui01100  Metabolic pathways
sui01110  Biosynthesis of secondary metabolites
sui01120  Microbial metabolism in diverse environments
sui01130  Biosynthesis of antibiotics
sui01200  Carbon metabolism
sui01212  Fatty acid metabolism
sui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUJS14_1611
   00630 Glyoxylate and dicarboxylate metabolism
    SSUJS14_1611
   00640 Propanoate metabolism
    SSUJS14_1611
   00650 Butanoate metabolism
    SSUJS14_1611
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSUJS14_1611
   00072 Synthesis and degradation of ketone bodies
    SSUJS14_1611
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUJS14_1611
   00310 Lysine degradation
    SSUJS14_1611
   00380 Tryptophan metabolism
    SSUJS14_1611
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUJS14_1611
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUJS14_1611
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSUJS14_1611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sui04147]
    SSUJS14_1611
Enzymes [BR:sui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUJS14_1611
Exosome [BR:sui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUJS14_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: ADV70671
Position
1593814..1594998
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system