KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00731Help
Entry
SAA6159_00731     CDS       T01870                                 

Gene name
tpi
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00010  Glycolysis / Gluconeogenesis
suj00051  Fructose and mannose metabolism
suj00562  Inositol phosphate metabolism
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01130  Biosynthesis of antibiotics
suj01200  Carbon metabolism
suj01230  Biosynthesis of amino acids
Module
suj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suj_M00002  Glycolysis, core module involving three-carbon compounds
suj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6159_00731 (tpi)
   00051 Fructose and mannose metabolism
    SAA6159_00731 (tpi)
   00562 Inositol phosphate metabolism
    SAA6159_00731 (tpi)
Enzymes [BR:suj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAA6159_00731 (tpi)
Exosome [BR:suj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAA6159_00731 (tpi)
  Exosomal proteins of bladder cancer cells
   SAA6159_00731 (tpi)
  Exosomal proteins of melanoma cells
   SAA6159_00731 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADL22678
Structure
PDB: 

Position
821637..822398
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNALPTLPDSKEVESVICAPAIQLDALTTAVKEGKAQG
LEIGAQNTYFEDNGAFTGETSPVALADLGVKYVVIGHSERRELFHETDEEINKKAHAIFK
HGMTPIICVGETDEERESGKANDVVGEQVKKAVAGLSEEQLKSVVIAYEPIWAIGTGKSS
TSEDANEMCAFVRQTIAGLSSKEVSEATRIQYGGSVKPNNIKEYMAQTDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagctggtaactggaaaatgaacaaaacagtacaagaagcaaaa
gacttcgtcaatgcattgccaacattaccagattcaaaagaagtagaatcagtaatttgt
gcaccagcaattcaattagatgcattaactactgcagttaaagaaggaaaagcacaaggt
ttagaaatcggtgctcaaaatacgtatttcgaagataatggtgcgttcacaggtgaaacg
tctccagttgcattagcagatttaggcgttaaatacgttgttatcggtcattctgaacgt
cgtgaattattccacgaaacagatgaagaaattaacaaaaaagcgcatgctattttcaaa
catggtatgacaccaattatttgtgttggtgaaacagacgaagagcgtgaaagcggtaaa
gctaacgatgttgtaggtgagcaagttaagaaagctgttgcaggtttatctgaagagcaa
cttaaatcagttgtaattgcttatgaaccaatctgggcaatcggaactggtaaatcatca
acatctgaagatgcgaatgaaatgtgtgcatttgtacgtcaaactattgctggcttatca
agtaaagaagtatcagaagcaactcgtattcaatatggtggtagtgttaaacctaacaac
attaaagaatacatggcacaaactgatattgatggggcattagtaggtggcgcatcactt
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system