KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_00736Help
Entry
SAA6159_00736     CDS       T01870                                 

Gene name
est
Definition
(GenBank) carboxyesterase precursor-like protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Brite
Enzymes [BR:suj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAA6159_00736 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Peptidase_S9 Abhydrolase_6 BAAT_C DUF2048 Abhydrolase_3 PhoPQ_related FSH1 Chlorophyllase2 DUF4611 Chlorophyllase Phage_HK97_TLTM
Motif
Other DBs
NCBI-ProteinID: ADL22683
Position
826578..827318
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LQSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKDQETIDNEMHHFKPTETLKELSEALDTIKEQVDEVLD
PILVIQAENDKMIDPQSANYIYDHVDSDDKDIKWYSESGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaagttaccaaagcctttcttttttgaggaaggtaaacgtgccgtgttatta
ctacatggttttacaggcaattcgtctgatgttcgtcaattaggtcgatttttacaaaag
aaaggttatacatcgtatgcaccgcaatatgaaggtcatgcagcaccaccagaagagata
cttcaatcaagtccttttgtttggtttaaagatgccttagatggctatgactaccttgtt
gaacaaggttatgatgaaatcgttgttgctggcttgtcattaggtggcgattttgcatta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgcaattttaaaaagtat
gagggtaaagatcaagaaacgatcgataacgaaatgcatcatttcaaaccaactgaaact
ttaaaagaattaagtgaagcattagatacgattaaagagcaagttgatgaagtgttggat
cctattttagtgattcaagctgaaaacgacaaaatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagatatcaagtggtacagtgaatctggacat
gttattacgattgataaagagaaagaacaagtatttgaagatatttatcaatttttagag
tcattagattggtcagaataa

DBGET integrated database retrieval system