KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_01240Help
Entry
SAA6159_01240     CDS       T01870                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00260  Glycine, serine and threonine metabolism
suj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01130  Biosynthesis of antibiotics
suj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6159_01240 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6159_01240 (trpA)
Enzymes [BR:suj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAA6159_01240 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth DUF561 IGPS
Motif
Other DBs
NCBI-ProteinID: ADL23179
Position
1364929..1365657
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFEQLEKHGNQIKCQYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPFELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKEIVSHAEGFIYTVTMNATTGQNGAFRPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKANTREEIIKYLQSIQHAL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcataacgata
gattatattttcgagcaattagaaaaacacggtaatcaaattaagtgtcagtatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gataccggtgtctacggcttaattattcctgatttaccatttgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaattatatcgttagttgcgatgactactgat
gacaaacgtataaaagaaatcgtatcccatgcggaagggtttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcgcccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaactccacaacat
gttgcagatataaaagaggtcgcagatggtatcgttattggtagtgaaatcgttaagcga
tttaaagctaacacgcgtgaagaaatcattaaatatttacaatctatccagcatgcattg
aataattaa

DBGET integrated database retrieval system