KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_01760Help
Entry
SAA6159_01760     CDS       T01870                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00860  Porphyrin and chlorophyll metabolism
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SAA6159_01760 (hemY)
Enzymes [BR:suj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SAA6159_01760 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SAA6159_01760 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 MCRA Pyr_redox HI0933_like NAD_binding_9 Thi4 FAD_binding_2 Mqo FMO-like FAD_binding_3 Glu_dehyd_C Prenylcys_lyase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADL23690
Position
complement(1917375..1918775)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGLDLLKKPTQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYSNQQEDVFDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDDKDIENTYDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDSVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgatcatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcttatatttttgcgaaaaacaaattgtatcctattcca
ggtggatcaattatgggaattccgacagatatcaaaccgtttgtgacaactaaattaatt
tcaccacttggaaagttaagagcagggttagatttacttaaaaaacctactcaaatgcag
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aatttaattgagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccaaaa
ggacaattcaaacaatttaagcatggtttaagctcatttattgaagcattagaacaagat
gtgaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatattattacatct
caaaagcaatataaaattgtttacagtaatcaacaagaagatgtattcgatggggtatta
gtgacaacaccgcatcaagtctttttgaattggttcgggcaagatccagcatttgattac
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgataaagac
attgaaaatacttatgatggtactggctttgtgattgcgagaacgagtgatactgacatt
accgcatgtacttggacatcgaaaaagtggccatttactacaccagaaggtaaggttttg
attcgtgcttatgtaggtaaaccaggtgatagtgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgttggtcacattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacacaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system