KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_02068Help
Entry
SAA6159_02068     CDS       T01870                                 

Gene name
mtlD
Definition
(GenBank) putative mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00051  Fructose and mannose metabolism
suj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAA6159_02068 (mtlD)
Enzymes [BR:suj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SAA6159_02068 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N NAD_Gly3P_dh_N UDPG_MGDP_dh_N Sacchrp_dh_NADP Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ADL23993
Structure
PDB: 

Position
2223039..2224145
Genome map
AA seq 368 aa AA seqDB search
MKAVHFGAGNIGRGFIGYILADNNVKVTFADVNEQIINALATEHQYDVILADESKTTTRV
NNVEAINSMQPSEELKQAILEADIITTAVGVNILPIIAKSFAPFLKEKTNHVNIVACENA
IMATDTLKQAVLDITGPLSDNIHFANSAVDRIVPLQKNENILDVMVEPFYEWVIEKDAWY
GPELNHIKYVDDLTPYIERKLLTVNTGHAYLAYAGKFADKATVLDAIEDSSIEAGLRRVL
SETSKYITNEFDFTEAEQAGYVEKIIDRFNNSYLSDEVTRVGRGTLRKIGPKDRIIKPLT
YLYNKDLERTGLLNTAALLLKYDDTADQETVEKNNYIKEHGLKAFLSEYAKVDDGLADEI
IEAYNSLP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcattttggtgctggtaatataggtcgtggatttattggatatattcta
gcagataacaacgtaaaagtaacatttgcagatgtaaatgaacaaatcattaatgcatta
gctactgaacatcaatatgatgttattttagctgatgagtctaaaacaacaacacgtgta
aataatgttgaagcgattaactcaatgcaaccttctgaagaattgaaacaagcaatttta
gaagctgatattattacaacagctgttggtgttaacatactacctattattgctaaatct
tttgcgcctttcttaaaagaaaaaacaaatcatgttaatatagtcgcttgtgaaaatgcc
attatggcaactgatactttgaaacaagcggttcttgatattactggccctcttagcgat
aatattcatttcgctaattctgctgttgatagaattgtaccattacaaaaaaatgaaaat
atattagatgttatggtagaaccattttatgaatgggttattgaaaaagatgcatggtac
ggtccagaacttaatcatattaaatatgttgatgatttaacaccatatattgagcgtaaa
ttattaactgtgaatacaggacatgcatatttagcgtatgctggtaaatttgcagataaa
gctacagttttagatgcaattgaagatagctcaattgaagctggtttacgccgtgtttta
tcagaaacaagtaaatatattaccaatgaatttgattttactgaagcggaacaagctggt
tatgttgaaaaaataatagaccgtttcaacaattcttatttatctgatgaagtgacacgt
gtcggacgaggtacgttacgtaaaattggccctaaagatagaattataaaaccattaaca
tatctttataataaagatttagaacgcactggtttattaaatacagctgcattgttattg
aagtatgatgatacagcagaccaagaaactgttgagaaaaataattacattaaagaacac
ggtttaaaagcgttcttaagcgaatatgctaaagttgacgatggcttagccgatgaaata
attgaagcgtacaattcacttccataa

DBGET integrated database retrieval system