KEGG   Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA): SAA6159_02269Help
Entry
SAA6159_02269     CDS       T01870                                 

Gene name
mqo1
Definition
(GenBank) putative malate:quinone oxidoreductase 1
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
suj  Staphylococcus aureus subsp. aureus JKD6159 (CA-MRSA)
Pathway
suj00020  Citrate cycle (TCA cycle)
suj00620  Pyruvate metabolism
suj01100  Metabolic pathways
suj01110  Biosynthesis of secondary metabolites
suj01120  Microbial metabolism in diverse environments
suj01200  Carbon metabolism
Module
suj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:suj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAA6159_02269 (mqo1)
   00620 Pyruvate metabolism
    SAA6159_02269 (mqo1)
Enzymes [BR:suj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SAA6159_02269 (mqo1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADL24191
Position
complement(2430379..2431857)
Genome map
AA seq 492 aa AA seqDB search
MTTQHSKTDVILIGGGIMSATLGTLLKELSPEKNIKVFEKLAQPGEESSNVWNNAGTGHS
ALCELNYTKEGKDGTVDCSKAIKINEQYQISKQFWAYLVKTGQLDNPDRFIQAVPHMSFV
IGEDNVAFIKSRVATLKKSVLFEKMKLSQDEEEMKSWVPLMIEGRKSDEPIALTYDETGT
DVNFGALTAKLFNNLEQRGVGIQYKQNVLDIKKQKSGAWLVKVKDLETNETTTYESDFVF
IGAGGASLPLLQKTGIKQSKHIGGFPVSGLFLRCTNQEVIDRHHAKVYGKAAVGAPPMSV
PHLDTRFVDGKRSLLFGPFAGFSPKFLKTGSHMDLIKSVKPNNIVTMLSAGIKEMSLTKY
LVSQLMLSNDERMDDLRVFFPNAKNEDWEVITAGQRVQVIKDTEDSKGNLQFGTEVITSD
DGTLAALLGASPGASTAVDIMFDILQRCYRDEFKGWEPKIKEMVPSFGYRLTDHEDLYHK
INEEVTKYLQVK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaacatagcaaaacagatgtcatcttaattggtggcggtattatgagtgca
acattaggaacattacttaaagaattatcacctgagaaaaatattaaagtgtttgaaaaa
ttagcacaacctggcgaagagagttcaaatgtatggaataatgccggtacagggcattca
gcactttgcgagttgaactatacaaaagaaggtaaggatggcacagttgattgtagtaaa
gcaattaagataaatgagcagtaccaaatttcaaaacagttttgggcatatttagttaaa
acaggacaattagataacccagatcgctttattcaagcggtgccacacatgagtttcgtc
attggcgaagataatgtagcttttataaaaagtcgtgttgcaacgttaaagaaaagtgtt
ttattcgaaaaaatgaaattatcgcaagatgaagaagaaatgaaatcttgggtaccgtta
atgattgaaggtcgtaagtctgatgaaccaattgctttaacttatgatgaaactggtaca
gatgttaattttggtgcgttaactgcaaagttatttaataatttagaacaacgtggtgtg
ggaattcaatataagcagaatgtattagacatcaagaaacagaaatccggggcatggcta
gttaaagttaaagatttagaaactaacgaaacgacaacatatgaatctgattttgtattt
attggtgctggcggtgcgagtttaccattactccaaaagactggaattaaacaatcaaaa
catattggtggtttcccagtaagtggattattcctgcgctgtacaaatcaagaagtgatt
gatcgtcatcatgctaaagtgtacggaaaagcagcagtgggtgcgccaccaatgtcagtg
ccgcacttagatacacgttttgtagacggcaagcgttcattgttatttggtccatttgca
ggtttctcacctaaatttttaaaaacaggttcacatatggatttaattaaatcggttaaa
ccaaataatatcgtgacgatgttatctgcaggtatcaaagaaatgagtcttacgaagtat
ttagtgtcacaattgatgttatctaatgatgagcgtatggatgatttaagagtctttttc
ccaaatgctaaaaatgaagattgggaagtgattacagcagggcaacgtgtccaagtaatc
aaggatactgaggattctaaaggtaacttacaatttggtactgaagtcattacgtcagat
gatggcacattagctgcattacttggtgcatcacctggtgcgtcaacagctgtagatatt
atgtttgatattttacagcgatgctatcgtgatgaattcaaagggtgggaaccaaagatt
aaagaaatggtgccgtcatttggttatcgcttaacagatcatgaggatttatatcacaaa
attaatgaagaagtaactaagtatttacaagttaaataa

DBGET integrated database retrieval system