KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_00583Help
Entry
SAA6008_00583     CDS       T01886                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00071  Fatty acid degradation
suk00072  Synthesis and degradation of ketone bodies
suk00280  Valine, leucine and isoleucine degradation
suk00310  Lysine degradation
suk00362  Benzoate degradation
suk00380  Tryptophan metabolism
suk00620  Pyruvate metabolism
suk00630  Glyoxylate and dicarboxylate metabolism
suk00640  Propanoate metabolism
suk00650  Butanoate metabolism
suk00900  Terpenoid backbone biosynthesis
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
suk01212  Fatty acid metabolism
suk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAA6008_00583 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAA6008_00583 (vraB)
   00640 Propanoate metabolism
    SAA6008_00583 (vraB)
   00650 Butanoate metabolism
    SAA6008_00583 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAA6008_00583 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SAA6008_00583 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAA6008_00583 (vraB)
   00310 Lysine degradation
    SAA6008_00583 (vraB)
   00380 Tryptophan metabolism
    SAA6008_00583 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAA6008_00583 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAA6008_00583 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAA6008_00583 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suk04147]
    SAA6008_00583 (vraB)
Enzymes [BR:suk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAA6008_00583 (vraB)
Exosome [BR:suk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAA6008_00583 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADL64643
Position
647964..649103
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEEFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagagttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system