KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01335Help
Entry
SAA6008_01335     CDS       T01886                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01130  Biosynthesis of antibiotics
suk01230  Biosynthesis of amino acids
Module
suk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6008_01335 (trpC)
Enzymes [BR:suk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAA6008_01335 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADL65378
Position
1423530..1424312
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINTIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttatcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
acaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaccaatatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacgacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatctgataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgttacaaatgtggaacatacaaatact
attttagaaaataaaaaaacaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system