KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01338Help
Entry
SAA6008_01338     CDS       T01886                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00260  Glycine, serine and threonine metabolism
suk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01130  Biosynthesis of antibiotics
suk01230  Biosynthesis of amino acids
Module
suk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6008_01338 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6008_01338 (trpA)
Enzymes [BR:suk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAA6008_01338 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth IGPS DUF561
Motif
Other DBs
NCBI-ProteinID: ADL65381
Position
1426171..1426872
Genome map
AA seq 233 aa AA seqDB search
MGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITIDYIFNQLEK
HGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRLKQQFSHYGV
KIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIESIKAIANVPV
VAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTLNN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaagatttgattgaaaatgcaacattgttgagtgaaaatggtgcagatata
attgaaattggagtacctttctctgatccggttgctgatggtccagttatcatggaagca
ggtcaacaagcgattaaacaaggcatcacgatagattatattttcaatcaattagaaaaa
catggtgatcaaattaagtgtaactatgtattaatgacgtattataatattatttgtcat
tatggagaacaagcgttttttgaaaaatgtcgagatactggtgtctacggcttaattatt
cctgatttaccatatgaattatcgcagcgtttaaaacaacaatttagtcactatggcgtc
aaaatcatatcgttagttgcgatgactactgatgacaaacgtataaaagatatcgtatcc
catgcggaaggctttatttatactgtgacgatgaatgcgacaacagggcaaaacggtgcg
tttcatccagaattaaaacgaaaaattgagtcaattaaagcgatagccaatgtgccagtt
gtcgcaggatttggtataagaacaccacaacatgttgcagatataaaagaggttgcagat
ggcattgtcattggtagcgaaatcgttaagcgatttaaatctaacacgcgtgaggaaatc
attaaatatttacaatctatccaacaaacattgaataattaa

DBGET integrated database retrieval system