KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01505Help
Entry
SAA6008_01505     CDS       T01886                                 

Gene name
gcvPA
Definition
(GenBank) glycine dehydrogenase, subunit 1 (glycine cleavage system P protein)
  KO
K00282  glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00260  Glycine, serine and threonine metabolism
suk00630  Glyoxylate and dicarboxylate metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAA6008_01505 (gcvPA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAA6008_01505 (gcvPA)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SAA6008_01505 (gcvPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADL65544
Position
complement(1622251..1623597)
Genome map
AA seq 448 aa AA seqDB search
MSHRYIPLTEKDKQEMLQTIGAKSIGELFGDVPSDILLNRDLNIAEGEAETTLLRRLNRI
ASKNITKETHTSFLGAGVYDHYAPSVVDAMISRSEFYTAYTPYQPEISQGELQAIFEFQT
LICELTDMDVANSSMYDGMTSFAEACILAFSQTKKNKIVVSKGLHYQALQVLHTYAKTRK
EFEVVEIDLDGTVTDLKKLEAAVDDETAAVAVQYPNFYGSIEDLEKIHSFIEDKKALFIV
YANPLALGLLTPPGLFGADIVVGDTQPFGIPAQFGGPHCGYFATTKKLMRKVPGRLVGQT
QDDEGNRGFVLTLQAREQHIRRDKATSNICSNQALNALASSIAMSALGKQGIYDIAVQNI
EHANYAKQQFIKKGFEVLDGTSFNEFVVKFDKPIQQVNEELVKYNIIGGFDLGVVSDDFK
NHMLIAVTELRTKDEIDTFVEKAGELND
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcatcgttatatacctttaactgaaaaagacaagcaagaaatgttacaaacaatt
ggtgcaaaatctataggagaattattcggtgatgtaccaagtgacattttattaaataga
gatttaaatattgctgaaggcgaagcggaaacaacgttacttagaagattaaatcgcatt
gcaagcaagaatatcactaaagaaacgcatacatcatttttgggtgctggtgtttatgat
cattacgcgccatcagttgtggatgctatgatttcaagatcagaattttacacagcatat
acgccatatcaaccggaaatttctcaaggtgaattacaagccatttttgagttccaaact
ttaatttgtgaattaacagatatggatgtagcaaattcttctatgtatgatgggatgact
agctttgctgaagcatgtatcttagcatttagtcaaacaaagaaaaataaaattgtagtc
tcaaaaggtttacattatcaagcattacaagtacttcatacttatgctaagacgcgtaag
gaattcgaagtagtggaaatcgatttagatggcactgttacagatttgaaaaaattagaa
gcagcagtggatgatgaaacagcagctgttgcagtacaatatccaaacttttacggttca
attgaagatcttgaaaagattcatagctttattgaagataaaaaagcattatttatcgta
tatgcaaatccattagcattgggattacttacacctccaggtttatttggtgcagatatt
gttgtaggtgatactcagccattcggaattcctgctcaattcggtgggccacattgtgga
tattttgcaacgacgaaaaagttaatgcgtaaagtgccaggtagattagtcggtcaaaca
caagatgatgaaggtaatcgtggctttgtattaacattacaagcacgtgaacaacatatt
cgacgcgataaagcgacatctaatatttgttctaaccaagcattaaatgctttagcgtca
tcaattgcaatgtcagcacttggtaaacaaggtatctatgatattgcagttcaaaatata
gaacatgctaactatgctaaacaacaatttattaaaaaaggttttgaagtattagatggt
acatctttcaatgagtttgtagtcaaatttgacaaaccaattcaacaagttaacgaggaa
ttagtgaagtacaatattatcggtggttttgatttaggtgttgtttcagacgactttaaa
aatcacatgttaatagctgtaactgaattaagaacaaaagatgaaatcgatacatttgta
gaaaaggctggtgagttaaatgactag

DBGET integrated database retrieval system