KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01507Help
Entry
SAA6008_01507     CDS       T01886                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase, AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01130  Biosynthesis of antibiotics
suk01230  Biosynthesis of amino acids
Module
suk_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAA6008_01507 (aroK)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SAA6008_01507 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA AAA_33 AAA_22 DUF836 AAA_24 CoaE Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ADL65546
Position
complement(1624867..1625391)
Genome map
AA seq 174 aa AA seqDB search
MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgataaatcaccaataattttaattggtttcatgggtaccggtaaatctacg
attggtaaatacgttgcagatgagcaaaatttatcatttattgatatagattcatatatc
gaagagaagtataagttaacaataccagaaatattttgtaaacatggtgaacaatatttc
aggaatttagagttcacatgtttgcaagaatgtattaacactgcagatataattgctact
ggtggtggtattattgagagtgaagaggcatttaattttttgaaaaatcaaaaaaacatt
atttggttagattgtaatattgatattatatatagtcgaatcaatgatgacccacatcga
cctaatgcaaataataagacaatcaagcagttaaatgacttgtattgctcgcggaattta
agatataatgaaatcgcattcaagaaatttgatagtcatttgctatcaatttcagaaata
tattatgaattgctaaatttaataaaagcgagtgatcagtattag

DBGET integrated database retrieval system